SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013579 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013579
Domain Number 1 Region: 5-438
Classification Level Classification E-value
Superfamily ALDH-like 8.12e-122
Family ALDH-like 0.000000000393
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013579   Gene: ENSSTOG00000015155   Transcript: ENSSTOT00000015157
Sequence length 470
Comment pep:known_by_projection scaffold:spetri2:JH393409.1:2087325:2097219:-1 gene:ENSSTOG00000015155 transcript:ENSSTOT00000015157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLEDTLRRLREAFGSGRTRPAEFRAAQLQGLGRFLKDNRQLLLDALAQDLGKSNFEAE
VSEIAISQSEVDLALRNLQTWMKDEKVSKNLATQLDSAFIRKEPFGLVLIVAPWNYPLNL
TLVPLVGAIAAGNCVVLKPSEISKSVEKVLAEVLPRYLDQSCLAVALGGPAETARLLEHR
FDYIFFTGPGSPRVGKTVMAAAAKHLTPVTLELGGKNPCYVDDDCDPQTVANRVTWFRYF
NAGQTCVAPDYVLCSPETRERLLPALQSAITRFYGDDPQSSPNLGRIISQKHFKRLQGLL
GCGRVAIGGQSDEGELYIAPTVLVDVQETEPVMQEEIFGPILPLVTVRSLDEAIDFINRR
EKPLALYAFSNSSQVVQRVLAQTSSGGFCGNDGFMHMTLASLPFGGVGASGMGRYHGKFS
FDTFSHHRACLLRSPGMEKINDLRYPPYSPRNLRVLLVAMEERRCSCTLL
Download sequence
Identical sequences ENSSTOP00000013579 ENSSTOP00000013579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]