SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013582 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013582
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily POZ domain 7.07e-30
Family Tetramerization domain of potassium channels 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013582   Gene: ENSSTOG00000015158   Transcript: ENSSTOT00000015160
Sequence length 184
Comment pep:known_by_projection scaffold:spetri2:JH393404.1:359850:369986:1 gene:ENSSTOG00000015158 transcript:ENSSTOT00000015160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XWVRLNVGGTYFVTTRQTLGREPKSFLCRLCCQEDPELDSDKDETGAYLIDRDPTYFGPI
LNYLRHGKLIITKELAEEGVLEEAEFYNIASLVRLVKERIRDNENRTSQGPVKHVYRVLQ
CQEEELTQMVSTMSDGWKFEQLISIGSSYNYGNEDQAEFLCVVSRELNNSTNGIVIEPSE
KAKV
Download sequence
Identical sequences ENSSTOP00000013582 ENSSTOP00000013582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]