SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013651 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013651
Domain Number 1 Region: 294-644
Classification Level Classification E-value
Superfamily RNI-like 5.65e-49
Family 28-residue LRR 0.048
Further Details:      
 
Domain Number 2 Region: 100-158
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000701
Family VWC domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013651   Gene: ENSSTOG00000015223   Transcript: ENSSTOT00000015232
Sequence length 669
Comment pep:known_by_projection scaffold:spetri2:JH393297.1:2118355:2139705:-1 gene:ENSSTOG00000015223 transcript:ENSSTOT00000015232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLAVWFCFVLLIIFQPDFGQNEDTPRKQRRKMYYRRLRKSSSLNHRSNRHAGIPQTAVA
PVARTLPTVHFDYSTEEKFESISSFPGVESSYDVLPGKKGHCLVKGITMYNKAVWSPEPC
TTCLCSDGKVLCDETMCHPQMCHHTVAPEGECCPVCTDTEQREPTNILHKPPPQVEMDQV
FRKEALESEEDEEVKENGHQEETAGPQDQGTLHSEEESRRQRKPSPGEGRPAHPWLYHGR
GEEEEEEENEEEGEEEEEEDAVRGDVFRLPSRFATAAPRRGKPHLPSSCSLSYRTISCVH
TALSHIPPLTAPEITSLELLGNSITSIPDEAFNGLPNLERLDLSKNNITSSGIGPKAFKL
LKKLTRLNMDGNNLVRIPSELPSTLEELKINENNLQAIDEESLSVDLNQLVTLELEGNNL
SEINVDPLAFKSLKSLSYLRLGKNKFRIIPQGLPASIEELYLENNQIEEITEICFNQTRK
INVIVLRYNNIEENRIAPLAWINQENLESIDLSYNKLYHVPSYLPKSLLHLVLIGNQIER
IPGYVFGHMEPGLEYLYLSFNRLNDDGLDRVSFYGAYHSLRELFLDHNDLKSIPPGVQEM
KALHFLRLNNNKIRNILPEQICNVEEDSDSTLEHLHLENNYIKVREISPYAFSCIRSYSS
VVLKPQNIK
Download sequence
Identical sequences ENSSTOP00000013651 ENSSTOP00000013651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]