SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013653 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013653
Domain Number 1 Region: 66-200
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 5.62e-40
Family Band 7/SPFH domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000013653
Domain Number - Region: 207-324
Classification Level Classification E-value
Superfamily ALDH-like 0.0183
Family ALDH-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013653   Gene: ENSSTOG00000015225   Transcript: ENSSTOT00000015234
Sequence length 355
Comment pep:known_by_projection scaffold:spetri2:JH393334.1:3129294:3132335:-1 gene:ENSSTOG00000015225 transcript:ENSSTOT00000015234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARAARGSGALLLRSAVQASAPPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILEP
GLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVED
PEYAVTQLAQTTMRSELGKLSLDKVFRERESLNANIVDAINQAADCWGIRCLRYEIKDIH
VPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQAA
GEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTILLPSN
PGDVTSMVAQAMGVYGALTKAPVPGAQNSVSTRSGSDVQGTDANLDEELDRVKLS
Download sequence
Identical sequences I3MPE5
ENSSTOP00000013653 ENSSTOP00000013653 XP_005326293.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]