SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013855 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013855
Domain Number 1 Region: 228-551
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.28e-64
Family Glutamine synthetase catalytic domain 0.00054
Further Details:      
 
Domain Number 2 Region: 119-224
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.31e-19
Family Glutamine synthetase, N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013855   Gene: ENSSTOG00000015471   Transcript: ENSSTOT00000015470
Sequence length 554
Comment pep:known_by_projection scaffold:spetri2:JH393286.1:1641135:1656245:1 gene:ENSSTOG00000015471 transcript:ENSSTOT00000015470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDPTKDESNETEASRMSKLRRTRKKATKSHLCSMEVGETNAASSNDSNRSETVNIVRLGY
AESHLSHNDKDSQDQTTMIKQSPFKMSSSAPGGESNSNSDRNRDNTQILTTPQLSSRIKH
IKQEMAKNHLQFVRFEATDLHGVSRSKSIPAHFFQEKVTHGVFMPRGYLELMPNLKDNEV
NHIRATCFNSDIVLMPELSTFRVLPWAERTARVICDTFTVTGEPLLTSPRYIAKRQLQQL
QDSGFSLLSAFIYDFCIFGVPEVINSKTISFPASTFLNNHDQPFMQELVDGLYHTGANVE
SFSSSTRPGHMEICFLPEFGISSADNAFTLRTGVKEVARKYNYIASFFIETGFCNSGILS
HSVWDMDGKKNMFCNNSGTEQLTVTGKKWLAGLLKHSAALSCLMAPAVSCRKRYSKESKD
LKESVPVTWGYNDNSCAFNIKCHGEKGTRIENKLGSATANPYLVLAATIAAGLDGLQNSD
GALVGPDEGTDLSQLKPSEIPLKLEDALVALEEDQCLREALGETFIRYFVAMKKYELENE
ETDAERNKFLEYFI
Download sequence
Identical sequences ENSSTOP00000013855 ENSSTOP00000013855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]