SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013915 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013915
Domain Number 1 Region: 265-370
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.81e-17
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.001
Further Details:      
 
Domain Number 2 Region: 1056-1099
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 4.51e-16
Family Nuclear receptor coactivator interlocking domain 0.00019
Further Details:      
 
Domain Number 3 Region: 121-186
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000327
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.035
Further Details:      
 
Domain Number 4 Region: 34-90
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000628
Family HLH, helix-loop-helix DNA-binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013915   Gene: ENSSTOG00000015543   Transcript: ENSSTOT00000015546
Sequence length 1099
Comment pep:known_by_projection scaffold:spetri2:JH393324.1:5907178:5932437:-1 gene:ENSSTOG00000015543 transcript:ENSSTOT00000015546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLGENLDPLASDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSDID
NFNVKPDKCAILKETVRQIRQIKEQGKAISSDDDVQKADVSSTGQGVIDKDSLGPLLLQA
LDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVNG
VSWTSETQRQKSHTFNCRMLMKTTHDILEDMNTSPEMRQRYETMQCFALSQPRAMMEEGE
DLQSCMICVARRITTGERAFQSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRC
IQRFFSLNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR
HGFVSTHFLQREQNGYRPNPNPVGQGIRPPVAGCSSMNMSPNQGLQMLSSRAYGLTDPNA
TGQISGTRYGASGNIASLTPGPGVQSPSSYQNNNYGLSMGSPPHGSPGLGSNQQSIMISP
RNRGSPKMASHQFSPVAGVHSPMGSSGSTGSHNFSSSSLSALQAISEGVGTSLLSTLSSP
GPKLDNSPNMNITQPSKVTSQDSKSPLGLYCDQNPVESSMCQSNSRDHLNDKESKESSGE
GSENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKDSSVSVTSPSGVSSSTS
GGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTTTCGEGNVKQE
QLSPKKKENNALLRYLLDRDDPSDALSKEPQPQVEGMDNKMSQCSSSTIPSSGQEKDSKI
KTETSEEGSGDLDNLDAILGDLTSSDFYNNPISTNGSHLGTKQPMFQGTNSLGLRSPQSV
QSARPPYNRAASLDSPVSVGSSPPIKNISAFPMLAKQPVLGGNPRMMDSQENYGSNMGGP
NRNVTLNQTPSPEWGLPNSKASRVEPMSSNSMGRPGDYSASLPRPAMGGSVPTLPLRSNS
IPGARPMLQQQQQQQQQHMLQRDFTTGLLENLYFRFVPPGPGEIPMGMGVNPYGQATPAN
QPGSWPDGMLSMEQGPHVPQNRPLLRNSLDDLLGPPSNPEGQSDERALLDQLHTLLSNTD
ATGLEEIDRALGIPELVNQ
Download sequence
Identical sequences ENSSTOP00000013915 ENSSTOP00000013915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]