SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013918 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013918
Domain Number 1 Region: 22-241
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-63
Family G proteins 0.000000982
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013918   Gene: ENSSTOG00000015547   Transcript: ENSSTOT00000015549
Sequence length 242
Comment pep:known_by_projection scaffold:spetri2:JH393319.1:3902052:4052320:-1 gene:ENSSTOG00000015547 transcript:ENSSTOT00000015549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPN
ESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGI
FHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLK
PEYDIMCKVKSWVMDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKK
NK
Download sequence
Identical sequences ENSSTOP00000013918 ENSSTOP00000013918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]