SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014074 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014074
Domain Number 1 Region: 174-322
Classification Level Classification E-value
Superfamily TPR-like 2.66e-19
Family Tetratricopeptide repeat (TPR) 0.0023
Further Details:      
 
Domain Number 2 Region: 7-94,132-158
Classification Level Classification E-value
Superfamily FKBP-like 8.64e-19
Family FKBP immunophilin/proline isomerase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014074   Gene: ENSSTOG00000015721   Transcript: ENSSTOT00000015724
Sequence length 330
Comment pep:known_by_projection scaffold:spetri2:JH393409.1:2274535:2280219:-1 gene:ENSSTOG00000015721 transcript:ENSSTOT00000015724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADIIARLREDGIQKRVIQEGRGELPSFQDGTKATFHYRTLHSDSEGTVLDDSRARGKPM
ELIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAAGKDPLEGQRH
CCGIAQMHEHSSLGHADLDALQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKAKAVP
LIHQEGNRLYREGQVKEAATKYYDAIACLKNLQMKEQPGSPDWIQLDQQITPLLLNYCQC
KLVAQEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAP
VVSRELRALEARIRQKDEEDKARFRGIFSH
Download sequence
Identical sequences I3MQ89
ENSSTOP00000014074 ENSSTOP00000014074 XP_005333399.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]