SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014156 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014156
Domain Number 1 Region: 29-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000408
Family VWC domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014156   Gene: ENSSTOG00000015795   Transcript: ENSSTOT00000015816
Sequence length 1461
Comment pep:known_by_projection scaffold:spetri2:JH393316.1:8802110:8870860:1 gene:ENSSTOG00000015795 transcript:ENSSTOT00000015816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVNLTACHIVFVLYILYPQYLFHQQSKVNTEETCNQNGHIFLDKDIWKPSPCDICVCNRG
HILCEKIECVEDLPCADAVIPPGECCPYCPVVSGAQPLSPFKGPPGSQGPRGERGPKGRP
GIDGEPGVPGQPGAPGPPGHPSHPGPDGMSRPFSAQMAGLDEKSGLGSQVGLMPGSVGPV
GPRGPQGLQGQQGGVGPTGPPGEPGEPGPMGPVGARGPEGPPGKPGEDGEPGRNGNTGEV
GFTGSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEVGATGAKGEAGPTGPMGAMGPLGPR
GMPGERGRLGPQGAPGQRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPE
GPQGQRGETGPPGPVGSQGLPGAMGTDGTPGAKGPTGSPGTSGPPGLTGPPGSPGPQGST
GPQGIRGQTGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPM
GERGSPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNP
GVQGPEGKLGPLGASGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVP
GQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVP
GDPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGSPGPTGTVGDTGPP
GLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEP
GPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQ
GLAGSPGPHGPNGVPGLKGGRGTQGPPGATGFPGSAGRVGPPGPAGAPGPAGPIGEPGKE
GPPGLRGDPGSHGRVGDRGPAGPPGGPGDKGDPGEDGQSGPDGPPGPAGTTGQRGIVGMP
GQRGERGMPGLPGPAGTPGKVGPTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTP
GRDGAVGEHGDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGDPGSRGPIGPPGRAGKR
GLHGPQGPRGDKGDSGDRGDRGQKGHRGFTGLQGLPGPPGPNGEQGSAGIPGPFGPRGPP
GPVGPLGKEGNPGPLGPIGPPGVRGSVGEAGPEGPPGEPGPPGPPGPPGHLTAALGDIMG
HYDESMPDPLPEFTEDQAAPDDKNKTDPGVHATLKSLSSQIETMRSPDGSKKHPARTCDD
LKLCHSTKKIGEYWIDPNQGSAEDAIKVYCNMETGETCISANPSSIPRKTWWASKSPDNK
PVWYGLDMNRGSQFAYGDHLSPNTAITQMTFLRLLSKEASQNITYLCKNSIGYMDEQAKS
LKKAVVLKGANDLEIKGEGNVRFRYTVLQDTCSKRNGNVGKTIFEYRTQNVARLPIIDLA
PVDVGGTDQEFGIEIGPVCFM
Download sequence
Identical sequences ENSSTOP00000014156 ENSSTOP00000014156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]