SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014264 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014264
Domain Number 1 Region: 350-488
Classification Level Classification E-value
Superfamily C-type lectin-like 7.35e-33
Family C-type lectin domain 0.00063
Further Details:      
 
Domain Number 2 Region: 210-348
Classification Level Classification E-value
Superfamily C-type lectin-like 1.01e-32
Family C-type lectin domain 0.0005
Further Details:      
 
Domain Number 3 Region: 1107-1224
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-29
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 4 Region: 1376-1515
Classification Level Classification E-value
Superfamily C-type lectin-like 1.89e-27
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 5 Region: 949-1094
Classification Level Classification E-value
Superfamily C-type lectin-like 2.19e-27
Family C-type lectin domain 0.0028
Further Details:      
 
Domain Number 6 Region: 1529-1662
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-26
Family C-type lectin domain 0.00073
Further Details:      
 
Domain Number 7 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.29e-25
Family Cysteine rich domain 0.004
Further Details:      
 
Domain Number 8 Region: 634-795
Classification Level Classification E-value
Superfamily C-type lectin-like 7.09e-25
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 9 Region: 1663-1795
Classification Level Classification E-value
Superfamily C-type lectin-like 8.05e-22
Family C-type lectin domain 0.0028
Further Details:      
 
Domain Number 10 Region: 501-625
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-19
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 11 Region: 1239-1359
Classification Level Classification E-value
Superfamily C-type lectin-like 6.82e-18
Family C-type lectin domain 0.0049
Further Details:      
 
Domain Number 12 Region: 798-932
Classification Level Classification E-value
Superfamily C-type lectin-like 1.23e-16
Family C-type lectin domain 0.017
Further Details:      
 
Domain Number 13 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000277
Family Fibronectin type II module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014264   Gene: ENSSTOG00000015933   Transcript: ENSSTOT00000015941
Sequence length 1874
Comment pep:novel scaffold:spetri2:JH393279.1:18839821:18963408:1 gene:ENSSTOG00000015933 transcript:ENSSTOT00000015941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMRWATPRHAAGLLLLLLWCFGMAEPSDPAGNHPFTIVNENTGKCIKPLVGWIVAKDCD
GSKDMLWKWVSQHRLFHLQSQKCLGLDINKPMDSLKMFSCDSNAMLWWKCEHHSLYGAAQ
YRLALKDGYAIASTNTSDVWKKGGSEDSLCDQPYHEVYTRDGNSYGRPCEFPFLIDGTWH
HDCILDDDHNGPWCATTLHYNYDQQWGICLIPENGCEGNWQKNEQIGSCYQFNNQATLSW
KEAYISCQSQGADLLSISSAAELTYLQGQEGIARMFWIGLNQLYSARGWEWSDHKPLSFL
NWDSDMPKAQIIGGSSCAGMDAESGLWQSISCEAQLSYVCKKPLNNTVELTDVWTYSHTR
CEEGWLPNNGFCYLLVNETGSWDEAHKKCKAFSSDLISIHSLADVEVVVTKFHNRNAKEE
IWTGLRNINRPTLFQWSDGTEVTLTYWNENEPNIPYNKTPNCVSCLGKLGYWKVQSCEEK
LKYICKKKGQKMNDSRSDKMCPPDEGWKRHGETCYKIYTDEVPFGTNCNLTITNRFEQEY
LNDMMKKYDKSLRKYFWTGLRDVDSRGEYSWATAGGIKQAVTFSNWNFLEPASPGGCVAM
STGKFLGKWVVKDCRSFRALSICKKISGSLEPEKAAPKPDGPCPEGWHGFPSGVSCYKAF
HAERIVRKRNWEEAERFCQALGAHLPSFSHMTEIKEYLHWLREQFSDQRWLWIGLNKRSP
DLQGSWQWSDRTPVSTIIMENEFQQDYDIRDCAAVKVIYKPWRRSWHFYDDGEYIYLRPF
ACDTKLEWVCQIPKGSTPKTPDWYNPERAGIHGPPVIIEGSEYWFVADPHLNYEEAVLYC
ASNHSFLATITSFTGLKAIKNKIANISSDEQKWWVRTSDQPLDRHFIYSRHPWHHFPMRF
GEECLHMSAKTWFMDLNKPTDCTTKLPFICEKYNVSSLEKYSPDSAAKVQCSGDWIPFQN
KCFLKIKPKSVKFSEARDICHSYGGTLPSVLSQSEQDFITSLLPDMEGSLWIGLRWNAYE
RINKWTDDRELTYSNFHPLLVGRMLSIPTNFFDEESHYHCAVILNLPKSPFTGSWNFTAC
SEYYFVSLCQKYSDTEDRQPLQNTSKTVKYLNNLYKIIPKTLTWLDAQKECLRENMHLVS
ITDAYQQAFLAVQAVLWNSSFWIGLFSQDDELNFGWSDGKPLHFSRWADNNRQLEDCVIL
DTDGFWKTADCNDKQPGAICYYPGNDTEKEVKQVKSVKCPSPVLNTPWISFQNSCYNFMI
TKNRHMATTQDEVHSKCQKLNSQSHMLSIRDEKENNFVLEQLLYFNYMASWVMLGITYEN
NSLMWFDKTMLSYTHWRAGRPTVKNGKFLAGLSTDGFWDIQTFNVVEETLNFYQHSILAC
KIEMVDYKEEHNTTLPQLIPYEDGIYNVVQKKLTWYEALKTCSQSGGHLASVHNENGQVF
LEDIVKRDGFPLWVGLSSHDGSESGFEWSDGSALDYIPWKGQKSPGNCLILDPKGIWKHE
KCNSVKDGAICYKPTKAKEQSPHPYSSRCPTTKENGSQWIQYRDHCYMADQALHSFSEAK
QLCSELDHSATIVTIEDENENKFVSTLMRENNNITMRVWLGLSQQSVDQSWNWLDGSEVT
FVRWENKSKSGDGKCSILLASNETWKKVECSRGYGRVVCKVPLDCPSSAWVQFKDSCYIF
LEEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILNTLKKQWKGPDDILLGMFYDTDD
ASFKWFDSSNMTFDKWEDQEDVEDLVDTCGFLHTKTGEWKKGNCEVSSVEGTLCKAAIPY
ILLSSFSDNHILISTLVIASTVILTVLGAIIWYLYKRNSNSGFTTVFSTTPQSHYDDDCV
LVVAEENECPVGFD
Download sequence
Identical sequences ENSSTOP00000014257 ENSSTOP00000014264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]