SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014281 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014281
Domain Number 1 Region: 412-522,635-785
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.34e-56
Family Phosphate binding protein-like 0.00000791
Further Details:      
 
Domain Number 2 Region: 14-398
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.06e-33
Family L-arabinose binding protein-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014281   Gene: ENSSTOG00000015957   Transcript: ENSSTOT00000015962
Sequence length 983
Comment pep:known_by_projection scaffold:spetri2:JH393614.1:488424:1182147:1 gene:ENSSTOG00000015957 transcript:ENSSTOT00000015962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKITYSIKVIEANNPFQAVQEACDLMTQG
ILALVTSTGCASANALQSLTDAMHIPHLFVQRNPGGSPRTACHLNPSPDGEAYTLASRPP
VRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQSFLDQASRLGLDVSLQKVDKNISHVFT
SLFTTMKTEELNRYRDTLRRAILLLSPQGAHSFINEAVETNLASKDSHWVFVNEEISDPE
ILDLVHSALGRMTVVRQIFPSAKDNQKCMRNNHRISSLLCDPQEGYLQMLQISNLYLYDS
VLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFRED
SSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKVVTVLE
EPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTSWNGMIG
ELISKRADLAISAITITPERESVVDFSKRYMDYSVGILIKKPEEKISIFSLFAPFDFAVW
ACIAAAIPVVGVLIFVLNRIQAVRAQSATQPRPSASATLHSAIWIVYGAFVQQGGESSVN
SVAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQVEMSYGTVRDSA
VYEYFRAKGTNPLEQDSTFAELWRTISKNGGADNCVSNPSEGIRKAKKGNYAFLWDVAVV
EYAALTDDDCSVTVIGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWWP
HTGRCGLTSHSSAQADGKSLKLHSFAGVFCILAIGLLLACLVAALELWWNSNRCHQETPK
EDKEVNLEQVHRRMNSLMDEDIAHKQISPASIELSALEMGGLAPSQALEPTREYQNTQLS
VSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSATMPSIQCKHRSPNGGLFRQSPVKTPIP
MSFQPVPGGVLPEALDTSHGTSI
Download sequence
Identical sequences ENSSTOP00000014281 ENSSTOP00000014281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]