SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014284 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014284
Domain Number 1 Region: 5-57
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000294
Family LEM domain 0.0036
Further Details:      
 
Domain Number 2 Region: 254-320,348-402
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000608
Family Ankyrin repeat 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000014284
Domain Number - Region: 159-194
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00837
Family N-terminal domain of RNase HI 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014284   Gene: ENSSTOG00000015964   Transcript: ENSSTOT00000015965
Sequence length 881
Comment pep:known_by_projection scaffold:spetri2:JH393470.1:2648486:2666149:-1 gene:ENSSTOG00000015964 transcript:ENSSTOT00000015965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDVTMDAVLARLKLLSPDDLREEVFRAGLKCGPITSTTRFIFEKKLAQALLEQGGVLPSS
LPNLRETAAALSQDTQRTLPSAEGNLTVQASFSEDRDFNYSVGLNPPEEEAVASKARPEP
LGASVRSNTHQAGATPSKEPSLYYGVCPVYEDGPVRNEKIHVYEDKKEALQAVKMIKGSR
FKAFPTREDAEKFARGICDYFPSPSRASSPLSPVRAAPLLSSGGLKDGLCLSEPETVNKE
RANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMH
VAAKENQASVCQLTLETLENPEFMRLMYPDDDQSMLQKRIRYIVDLYLNTPDKVGYDTPL
HFACKFGNADVVSVLSSHPLIVKNPRNKYGKTPEDVICERSKNKPVELKERIREYLKGHY
YVPLLRAEDTSSPVIGELWSSDQTAEASNTSHCGSDPREPVLTLRAFAGPLSPAKAEDFR
RLWKTPPREKASFFHSVRKSDPERGIERVGRELAHELGYPWVEYWEFLDCFVDLSSQEGL
QRLEEYLAQQEMGRKEACPRDQTPTSGSRKKGSNSISVGAFLDEDNDVSLEEITNGQNAA
PHQSQPTVSAFGNLEHSGLSQGQQADPVGASDQHHPHTSRNKFCSPLTHSRIPGVEKPEA
LSGEEALLSPISSLTLEFDKMDLRNLKDSLSKTANKNMKTKDQILTSRKDIPPAAAVGLG
NDQMRTDGEMSAGLAKMSLDPNSPEWGNQQISTRDSTRRLFLFGEEPSKLDRDVLAALER
ADVDPYLFPAVHRWKSTVLCYSPSDRQSWPSPALKGKFKSQLPDLGCPHSYNPVRSGAAG
SSPGKLSHASCSPGLGSPRRYSPAHGSHLRRVAHIAQLTAL
Download sequence
Identical sequences ENSSTOP00000014284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]