SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014302 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014302
Domain Number 1 Region: 156-276
Classification Level Classification E-value
Superfamily TIMP-like 8.16e-37
Family Netrin-like domain (NTR/C345C module) 0.00021
Further Details:      
 
Domain Number 2 Region: 15-128
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-34
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014302   Gene: ENSSTOG00000015983   Transcript: ENSSTOT00000015983
Sequence length 276
Comment pep:known_by_projection scaffold:spetri2:JH393350.1:4427388:4484316:-1 gene:ENSSTOG00000015983 transcript:ENSSTOT00000015983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSAAEPNERGDQYCGGRLERPSGSFKTPNWPDRDYPAGVTCVWHIIAPKNQLIELKFEK
FDVERDNYCRYDYVAVFNGGEVNDAKRIGKYCGDSPPAPIVSEKNELLIQFLSDLSLTAD
GFIGHYKFRPKKLPTTTAVPVTTTFPVTVGLKPTVALCQQKCKRTGTLESNYCSSNFVLA
GTVITTVTRGGSLHATVSIINIYKEGSLAIQQAGKNMSAKVIVVCKQCPLLRRGLNYIIM
GQVGEDGRGKIMPNSFIMMFKTKNQKLLNALKNKQC
Download sequence
Identical sequences ENSSTOP00000014302 ENSSTOP00000014302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]