SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014360 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014360
Domain Number 1 Region: 45-284
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.36e-65
Family Alanine racemase-like, N-terminal domain 0.0000000435
Further Details:      
 
Domain Number 2 Region: 249-419
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.77e-29
Family Eukaryotic ODC-like 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014360   Gene: ENSSTOG00000016045   Transcript: ENSSTOT00000016046
Sequence length 459
Comment pep:known_by_projection scaffold:spetri2:JH393284.1:15942759:15973188:1 gene:ENSSTOG00000016045 transcript:ENSSTOT00000016046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLSESDFVMVEEGFSTKDLLEELTLGASQATTGEVAAFFVADLGAVVRKHFCFLKCL
PRVRPFYAVKCNSSLGVLKVLAELGLGFSCANKAEMELVQRIGVPASKIIYANPCKQIAQ
IKYAAKHGVRLLSFDNEMELAKVVKSHPSAKMVLCIATDDSHSLSRLSLKFGASLKSCRH
LLENAKKSHMEVVGVSFHVGSGCPDPQAYAQSIADARLVFEMGAELGHTMHILDLGGGFP
GIEGAKVRFEEIASVINSALDLYFPEGCGVDILAELGRYYVTSAFTVAVSIIAKKEVLLD
QPGREEENGSAPKTIVYHLDDGVYGIFNSVLFDNICPTPILQKKPSTEQPLYSSSLWGPA
DVRDCVAEGLWLPQLHVGDWLVFDNMGAYTVGTGSLLGGTQACRITYAMSRVAWEALRRQ
LLPAEQDEDAEGMCKPLSCGWEITDTLCVGPVFTPASIM
Download sequence
Identical sequences I3MQT9
ENSSTOP00000014360 NP_001280676.1.77405 XP_021588432.1.77405 ENSSTOP00000014360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]