SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014514 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014514
Domain Number 1 Region: 35-552
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 2.62e-168
Family Aconitase iron-sulfur domain 0.00000000000000252
Further Details:      
 
Domain Number 2 Region: 559-778
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 6.87e-65
Family LeuD-like 0.00000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014514   Gene: ENSSTOG00000016210   Transcript: ENSSTOT00000016215
Sequence length 782
Comment pep:known_by_projection scaffold:spetri2:JH393302.1:407858:430347:-1 gene:ENSSTOG00000016210 transcript:ENSSTOT00000016215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKPHSMVVTLYSLEKALGVRQYHVASVLCQRAKVAMSHFEPNEYIRYDLLEKNINIVRKR
LNRPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKV
AVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIIL
ENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSL
SGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFP
YNHRMKKYLNKTGRADIANLAEEFKDHLVPDPGCQYDQVIEINLNELKPHINGPFTPDLA
HPVAEVGTVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITP
GSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTG
RNDANPETHAFVTSPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELPRAEFD
PGQDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHIS
AAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWV
VIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKI
HPVDKLTIQGLKDFAPGKPLKCIIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKEL
QQ
Download sequence
Identical sequences ENSSTOP00000014514 ENSSTOP00000014514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]