SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014597 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014597
Domain Number 1 Region: 1061-1358
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.42e-69
Family Protein kinases, catalytic subunit 0.0000402
Further Details:      
 
Domain Number 2 Region: 132-231
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000866
Family N-terminal PAS domain of Pas kinase 0.00000837
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000014597
Domain Number - Region: 242-314
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00138
Family Heme-binding PAS domain 0.021
Further Details:      
 
Domain Number - Region: 349-387
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00332
Family Heme-binding PAS domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014597   Gene: ENSSTOG00000016299   Transcript: ENSSTOT00000016304
Sequence length 1387
Comment pep:known_by_projection scaffold:spetri2:JH393555.1:671234:703752:1 gene:ENSSTOG00000016299 transcript:ENSSTOT00000016304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARGLLAFDDDRRCLSGSLPVPVPTEGPAAEAASGSSKPFSSAHRHLSRKNGLSKLCQS
RIALSEDRWSSYCLSSLAAQNICTSKLRCPVAPELVDAAGSLGSASCCSLLRGLSAGGTA
PPFPAPVCNPNKAVFTVDAKTTEILVANDKACSLLGYSSQDLIGQKLAQFFLKSDSAVVE
ALSQEHVEADGHAAVVFSTVVDIVSRSGEKVPVSVWMKRVRQERGLCCVVVLEPVERVSA
WVAFQSDGTITACDSLFAHLHGFASGEDVVGQHLTDLIPSVQLPPPGQPVPKSLQIQRSV
GRARDGTTFPLSLKLKAKLSDQEVASSKEAPELDYWASVWVFCTISGLVTLLPDGTIYGI
NHSFALTLFGYGRTELLGKNITFLIPGFYHYMDLACDSSSQLPDLADCLDIHSESRPGQM
SWDPGSGAQDLKVNVVRASDHLLPQDETLKLARSQGIAPAQTRQEVGAWLPSSSSEPSPG
VDSVPEGSPPAHGEQSSSTDQQSVPEGSPPAHREQLSPRDQQSVSEGSPPTHREQLSPRD
QQSVPEGSPPAHREQLSPMDQDQQDAPEGSPPAQDDQSLFIDQERAALGKEEPAATEDPR
QGPLGESRSEPVDTNSWASCGGSEPPGPAEDRDSGLSLEAQQELIGVLSPSPWTDPARLQ
PQTAGQLATGGLLMHCPLYSSKWALRQLAPSPSGRASISLGTPTLDEPWLGAQDNREELQ
TCLTKERLSKLSCTGPLGLSCHEQVPAEHPPSAPMSFCDLGGRDLHSSHLGSSSACYALA
TDLPGVLEVVEAQEAQEAQEADVNSYSWNLKELFLSDLAERASSSCSCATSELSETPSPV
VVGSDEEVGHLHRQRPDILGDRELLLLAGTYFDPGDGLQFQESPLGHDQTELSEICLVSP
EHHKAHDMESPDYILPTLDVSPEHTCPSAEDPRLSAQVTSTPVAPRAASLQQQIQEGTYS
GSCYHRDGLRLSIQFEVKRVELQGSATLFCCWLVKNLLQSHRNSATRTRLLLASLPSSSH
SMSELPGPSLGEMLRAKPWFEESPTPVELAELAACEGEYSHKYSTLSPIGSGAFGFVWTA
VDKAQNKEVVVKFIKKEKILEDCWVEDPKLGKVTLEIAILSRVEHANIIKVLDVFENQGF
FQLVMEKHGSGLDLFAFIDCHPSLDEPLASYIFRQLVSAVGYLRSKGIVHRDIKDENIVI
AEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTL
IFEENPFCEVEETMEAAIHPPRPVSQALMSLVSGLLQPAPEQRTTLEKLVTDPWVTQPVN
LAAYTWEEVCRISQPESNLLSTASLELGNRSLSDVPRARGLCRLPTPSESPSGQCCLCPE
DPSPPVG
Download sequence
Identical sequences ENSSTOP00000014597 ENSSTOP00000014597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]