SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015118 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015118
Domain Number 1 Region: 17-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 4.84e-24
Family Ribosomal L11/L12e N-terminal domain 0.00044
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 4.71e-18
Family Ribosomal protein L11, C-terminal domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015118   Gene: ENSSTOG00000025971   Transcript: ENSSTOT00000023127
Sequence length 158
Comment pep:known_by_projection scaffold:spetri2:JH393409.1:3134876:3136446:1 gene:ENSSTOG00000025971 transcript:ENSSTOT00000023127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLSRATRALKKPEASGVIRTIVRAGQAMPGPPLGPILGQRGVSINQFCKEFNERTKDI
IEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVSLKHIYEI
ARVKAQDDAFALQDVHLSSVVRSIVGSARSLGIRVVKE
Download sequence
Identical sequences I3MSM3
ENSSTOP00000015118 XP_013217435.1.77405 ENSSTOP00000015118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]