SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015201 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015201
Domain Number 1 Region: 38-193
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 2.75e-85
Family Hedgehog (development protein), N-terminal signaling domain 0.0000000446
Further Details:      
 
Domain Number 2 Region: 198-314
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.88e-28
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015201   Gene: ENSSTOG00000021031   Transcript: ENSSTOT00000027983
Sequence length 315
Comment pep:known_by_projection scaffold:spetri2:JH393337.1:10033732:10042600:-1 gene:ENSSTOG00000021031 transcript:ENSSTOT00000027983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLARCLLVVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDFLT
FLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSAGDPEAPWGTGLPPGRRALF
ASRVRPGQRVYVVTE
Download sequence
Identical sequences ENSSTOP00000015201 ENSSTOP00000015201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]