SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015342 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015342
Domain Number 1 Region: 2-105,190-209,258-381
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.65e-44
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 
Domain Number 2 Region: 1504-1578,1630-1775,1833-1901
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.41e-42
Family WD40-repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 616-961
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.92e-41
Family WD40-repeat 0.0013
Further Details:      
 
Domain Number 4 Region: 659-752,935-1087,1162-1206,1386-1470
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.45e-40
Family Quinoprotein alcohol dehydrogenase-like 0.04
Further Details:      
 
Domain Number 5 Region: 456-535
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000142
Family WD40-repeat 0.014
Further Details:      
 
Domain Number 6 Region: 134-239
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000212
Family Quinoprotein alcohol dehydrogenase-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015342   Gene: ENSSTOG00000021646   Transcript: ENSSTOT00000029188
Sequence length 1903
Comment pep:known_by_projection scaffold:spetri2:JH393301.1:1254546:1405364:1 gene:ENSSTOG00000021646 transcript:ENSSTOT00000029188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLALHPDKTLIATGQVGKEPYICIWDSYNVQTVSILKDVHTHGVACLAFDSDGQRLASV
GLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQPNRVVSCGVKHIKFWTLCGNAL
TAKRGIFGKTGDLQTILCLACAKEDVTYSGALNGDIYVWKGLNLVRTIQGAHSAGIFSMY
ACEEGFATGGRDGCIRLWDTDFKPITKIDLRETEQGYKGLSIRSVCWRADRLLAGTQDSE
IFEVIVRERDKPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARCN
MEEAVRSVAFSPDGSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYLA
VGSNDGPVDIYAVAQRYKKIGECNKSLSFITHIDWSLDSKYLQTNDGAGDRLFYKMPSGK
PLTSKEEIKGIPWASWTCVKGPEVSGIWPKYTEVTDINSVDANYNSSVLVSGDDFGLVKL
FKFPCLKKGAKFRKYVGHSAHVTNVRWSHDCQWVLSTGGADHSVFQWRFIPEGVSNGMLE
TAPQENSLSEESGHSPPCHGDVPREMMVVKNEKDIIYLRKVYKEDLPQLKQQSKEKNHAM
PFLKREKAPEDSLKLQFIHGYRGYDCRNNLFYTQAGEVVYHIAAVAVVYNRQQHSQRLYL
GHDDDILSLTIHPVKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVCALDFSADG
KCLVSVGLDDFHSIVFWDWKKGEKIATTRGHKDKIFVVKCNPHHVDKLVTVGMKHIKFWQ
QAGGGFTSKRGIFGSAGKLETMMCVSYGRMEDLVFSGAATGDIFIWKDVLLLKTVKAHDG
PVFAMYALDKGFVTGGKDGIVELWDDMFERCLKTYAIKRAALSTSSKGLLLEDNPSIRAI
TLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRI
WELSSQHRMLAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTVEDMVSFHHRKEM
ISDIKFSKDTGKYLAVASHDNFVDIYNVLTSKRVGICKGASSYITHIDWDSRGKLLQVNS
GAKEQLFFEAPRGKRHIIRPSEIEKIEWDSWTCVLGPTCEGIWPVHSDVTDVNAASLTKD
CSLLATGDDFGFVKLFSYPVKGQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGADTALM
IWTREFVGTQESKLVDSEESDTDAEEDGGYDSDVAREKAIDYTTKIYAVSIREMEGTKPH
QQMKEVSMEERPPVSRAAPQPEKLQKNNITKKKKLVEELALDHVFGYRGFDCRNNLHYLN
DGADIIFHTAAAGIVQNLSTGSQSFYLEHTDDILCLTVNQHPKYRNVVATSQIAIGDSEK
KPGTTPSIHIWDAMTKHTLSMLRCFHSKGVNYVNFSATGKLLVSVGVDPEHTITVWRWQE
GAKVASRGGHLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSALLYKKGVIGSMEAAKM
QTMLSVAFGANNLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGK
ERPTKEGGAVKLWDQEMKRCRAFQLETGQLVECVRSVCRGKGKILVGTKDGEIIEVGEKN
AASNILIDGHMEGEIWGLATHPSKDIFISASNDGTARIWDLADKKLLNKVNLGHAARCAA
YSPDGDMVAIGMKNGEFVILLVNSLKVWGKKRDRKSAIQDIRISPDNRFLAVGSSEHTVD
FYDLTQGTSLNRTGYCRDIPSFVLQMDFSADSKYIQVSTGAYKRQVHEVPLGKQVTEAMV
IEKITWASWTSILGDEVIGIWPRNADKADVNCACVTHAGLNIVTGDDFGLVKLFDFPCTE
KFAKHKRYFGHSAHVTNIRFSYDDKYVVSTGGDDCSVFVWRCL
Download sequence
Identical sequences ENSSTOP00000015342 ENSSTOP00000015342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]