SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015682 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015682
Domain Number 1 Region: 122-250
Classification Level Classification E-value
Superfamily DNA clamp 5.34e-41
Family DNA polymerase processivity factor 0.000000919
Further Details:      
 
Domain Number 2 Region: 1-117
Classification Level Classification E-value
Superfamily DNA clamp 8.48e-30
Family DNA polymerase processivity factor 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015682   Gene: ENSSTOG00000026806   Transcript: ENSSTOT00000020471
Sequence length 256
Comment pep:novel scaffold:spetri2:JH393351.1:4410583:4416188:1 gene:ENSSTOG00000026806 transcript:ENSSTOT00000020471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEERLVQGSILKKVLEALKDLINEACWDISSGGVNLQSMDSSHSLVQLTLCSEGFDTYC
CNRNLAMGNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMLNN
FGIPEQEYSCVVKMPSGEFAHICRDLSHTGDAVVISYAKDGVKLSASRELRNGNNKLSQT
NNVDKEKEAVIIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYKIADMG
HLKYYLAHKIKDEEGS
Download sequence
Identical sequences ENSSTOP00000015682 ENSSTOP00000015682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]