SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015750 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015750
Domain Number 1 Region: 702-1281
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.01e-203
Family Myeloperoxidase-like 0.000000000456
Further Details:      
 
Domain Number 2 Region: 29-216
Classification Level Classification E-value
Superfamily L domain-like 8.16e-43
Family Ngr ectodomain-like 0.0017
Further Details:      
 
Domain Number 3 Region: 309-403
Classification Level Classification E-value
Superfamily Immunoglobulin 3.08e-26
Family I set domains 0.018
Further Details:      
 
Domain Number 4 Region: 393-488
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-24
Family I set domains 0.0094
Further Details:      
 
Domain Number 5 Region: 492-581
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-23
Family I set domains 0.074
Further Details:      
 
Domain Number 6 Region: 212-307
Classification Level Classification E-value
Superfamily Immunoglobulin 5.73e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 7 Region: 1382-1439
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000001
Family VWC domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015750   Gene: ENSSTOG00000020472   Transcript: ENSSTOT00000024549
Sequence length 1446
Comment pep:known_by_projection scaffold:spetri2:JH393342.1:462396:543557:-1 gene:ENSSTOG00000020472 transcript:ENSSTOT00000024549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGCPSRCLCFRTTVRCMHLLLEAVPAVAPQTSILDLRFNRIREIQPGAFRRLRNLNTLLL
NNNQIKKIPSGAFEDLENLKYLYLYKNEIQSIDRQAFTGLASLEQLYLHFNQIETLDPAS
FQHLPRLERLFLHNNRITHLVPGTFSHLESMKRLRLDSNALHCDCEILWLADLLKAYAQS
GNAQAAATCEYPRRIQGRSVATITPEELNCERPRITSEPQDADVVPGNTVYFTCRAEGNP
KPEIIWLRNNNELSMKTDSRLNLLDDGTLMIQNTQETDQGIYQCMAKNVAGEVKTQEVTL
RYFGSPARPAFVIQPQNTEVLVGESVTLECSATGHPPPRISWTRGDRTALPADPRVNITP
SGGLYIQNVAPGDSGEYTCFASNGIDSIHATAFIIVQALPQFTVTPEDRVVIEGQTVDFQ
CEATGNPQPVIAWTKGGSQLSVDRRHLVLSSGTLRISGVALHDQGQYECQAVNIIGSQKV
VVHLTVQPRVTPVFTSIPSDLTVEVGTNVQLPCSSQGEPQPAITWNKDGVQVTESGKFHI
SPEGFLTINDVGTADVGRYECVARNTIGYASVGMVLSVNVPDISRNGDPFVATSIVEAIA
TVDRAINSTRTHLFDSRPRSPNDLLALFRYPRDPYTVGQARAGEIFERTLQLIQEHVQHG
LMVDLNGTSYHYNDLVSPQYLSLIANLSGCTAHRRVNNCSDMCFHQKYRTHDGTCNNLQH
PMWGASLTAFERLLTAVYENGFNTPRGVNPQRLYNGHVLPMPRLVSTTLIGTEAVTADEQ
FTHMLMQWGQFLDHDLDSTVVALSQARFSDGQHCSSVCSNDPPCFSVMIPPNDPRVRSGA
RCMFFVRSSPVCGSGMTSLLMNSVYPREQINQLTSYIDASNVYGSSDHEARSIRDLASHR
GLLRQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFR
EHNRIATELLKLNPHWDGDTIYHETRKIVGAEIQHITYQHWLPKVLGEVGMKMLGEYRGY
DPNVNAGIFNAFATAAFRFGHTLINPVLQRLDENFQPIAQGHIPLHKAFFSPFRIVNEGG
IDPLLRGLFGVAGKMRVPSQLLNTELTERLFSMAHTVALDLAAINIQRGRDHGIPPYHDY
RVYCNLSAAHTFEDLKNEIKNPEIREKLRRLYGSTLNIDLFPALMVEDLVPGSRLGPTLM
CLLSTQFRRLRDGDRLWYENPGVFSPAQLTQLKQTSLARILCDNSDNITRVPGDVFRVAE
FPHGYGSCEDIPRVDLRVWQDCCEDCRTRGQFNAFSYHFRGRRSLDFSYREDNPRRGMRP
RKMRSALKPSEPQGNTTSAARERPGAPVTSDFREFVLEMQRTITELRKQINRLESRLSTT
ECVDASGEPRVNSATWRPDPCTVCGCKDGQVTCFVESCPPATCPEPVETEGACCPVCVEK
GPEEKP
Download sequence
Identical sequences ENSSTOP00000015750 ENSSTOP00000015750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]