SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015824 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015824
Domain Number 1 Region: 668-861
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000341
Further Details:      
 
Domain Number 2 Region: 472-591
Classification Level Classification E-value
Superfamily PH domain-like 2.16e-17
Family Pleckstrin-homology domain (PH domain) 0.0087
Further Details:      
 
Domain Number 3 Region: 10-97
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000254
Family SH3-domain 0.0033
Further Details:      
 
Domain Number 4 Region: 243-279
Classification Level Classification E-value
Superfamily WW domain 0.000000133
Family WW domain 0.0023
Further Details:      
 
Domain Number 5 Region: 241-330,362-438
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000018
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015824   Gene: ENSSTOG00000021140   Transcript: ENSSTOT00000024423
Sequence length 864
Comment pep:known_by_projection scaffold:spetri2:JH393351.1:1651832:1681213:-1 gene:ENSSTOG00000021140 transcript:ENSSTOT00000024423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADVEGDVYVLVEHPFEYTGKDGRLVAIQPNERYRLLRRSTEHWWHVRREPGGRPFYLP
AQYVRELPALGDPAAAPQSPAPHTSPAVPEPLTYDYRFVNLSAPTGSDHTPGEPRGRASS
LCGPVRRSGAAQRSSLAPGGPTSLYARPLAPVRPAQSLDDLARAAAPPAGLLGSAGRFKA
CSVAGSWVCPRPLARSDSENIYEAIPDVRSPQREDIPEQADDPQEPVYANVERQPRATSP
RAVAAPGPSPVWETHTDAGTGRLYYYNPDTGVTTWESPFEAAEGPASPATSPASVGSPES
LEGEWGQYWDEESRRVFFYNALTGETAWEDDPEDQLEMQPGLSPGSPMDQRPPTPETDYP
ELLTSYPEEDYSPVGSFSEPSPTCPLAAPPGWSCHISPDKQMIYTNHFTQEQWMKLEDQQ
GKPYFYNPEDSSVRWELPQVPIPAPRSICKSSQDSDTPAQPSLPEEKIKTLDKAGVLYRT
KTVDKGKRLRKKHWSASWTVLEGGVLTFFKDSKTSAAGGLRQPYKLSTPEYTVELKGATL
SWAPKDKSSKKNVLELQSRDGSEYLIQHDSEAIISTWQKAIAQGIQELSADLPAEEESET
GSADFGSSERLGSWREREDDTRSSAAGPVLSPGGQESDLSKVRHKLRRFLQRRPTLQSLR
EKGYIRDQVFGCALAVLCEREKSSVPRFVQQCIRTVEARGLDIDGLYRISGNLATIQKLR
YRVDHDERLDLDDGRWEDVHVITGALKLFFRELPEPLFPFSHFSQFIAAIKLQDQAQRSR
CVRDLVRSLPTPNHDTLRLLFQHLCRVIQHGEQNRMSVQSVAIVFGPTLLRPETEENSMT
MTMVFQNQVVELILQQCSDIFPPH
Download sequence
Identical sequences ENSSTOP00000015824 ENSSTOP00000015824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]