SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015829 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015829
Domain Number 1 Region: 5-190
Classification Level Classification E-value
Superfamily ITPase-like 9.94e-62
Family ITPase (Ham1) 0.0000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015829   Gene: ENSSTOG00000021471   Transcript: ENSSTOT00000026928
Sequence length 209
Comment pep:known_by_projection scaffold:spetri2:JH393295.1:15499287:15511955:-1 gene:ENSSTOG00000021471 transcript:ENSSTOT00000026928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLTGKKIVFVTGNAKKLEEVIQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEA
ARQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLYQLLAGFEDKSAYALCTFAL
STGEPSEPVHLFRGRTSGQIVVPRGCRDFGWDPCFQPDGYEQTYAEMPKAKKNVISHRFR
ALLELQKYFGSMTPPEAGGDHSGQGSGEG
Download sequence
Identical sequences I3MUN4
ENSSTOP00000015829 XP_005320582.1.77405 ENSSTOP00000015829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]