SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015921 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015921
Domain Number 1 Region: 31-106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000439
Family Growth factor receptor domain 0.0048
Further Details:      
 
Domain Number 2 Region: 94-165
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000255
Family Fibronectin type I module 0.018
Further Details:      
 
Domain Number 3 Region: 196-241
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000127
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015921   Gene: ENSSTOG00000020335   Transcript: ENSSTOT00000029934
Sequence length 348
Comment pep:known_by_projection scaffold:spetri2:JH393370.1:42390:46009:-1 gene:ENSSTOG00000020335 transcript:ENSSTOT00000029934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVGPVRFAFVLLLALCSRPATGQDCGGQCQCGTAPAPRCPAGVSLVLDGCGCCRVCA
KQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCVFGGTVYRSGESFQSSCK
YQCTCLDGAVGCVPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDHTVVGPALAA
YRLEDTFGPDPTMMRANCLVQTTEWSACSKTCGMGISTRVTNDNAFCRLEKQSRLCMVRP
CEADLEENIKKGKKCIRTPKISKPVKFELSGCTSVKTYRAKFCGVCTDGRCCTPHRTTTL
PVEFKCPDGEIMKKSMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
Download sequence
Identical sequences I3MUX6
XP_005329817.1.77405 XP_015356822.1.40921 ENSSTOP00000015921 ENSSTOP00000015921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]