SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016387 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016387
Domain Number 1 Region: 41-295
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.8e-80
Family Carbonic anhydrase 0.00000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016387   Gene: ENSSTOG00000026367   Transcript: ENSSTOT00000024755
Sequence length 296
Comment pep:novel scaffold:spetri2:JH393429.1:3028620:3032664:-1 gene:ENSSTOG00000026367 transcript:ENSSTOT00000024755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGQGPVRLGLGALLGLTQLVPGATTPRTQSVTWWLGQVQDGGKGPTHWKELAPACGGPTQ
SPINIDLHLVQKDSTLQPFIFQGYNLAPPGPWSLENDGHTGQHPRNGLEIWGAGLPPPAY
RALQLHFHWGAPGHTGSEHSLDGQRYSMEMHIVHINKKYQSMEEARRHPDGLAVLAVLLA
EQDQDNANFSAIVLGLKNVSIPGVSVNMTSTFPLSSLLPSPLGLLRYYRYSGSLTTPGCE
PSVLWTVFENAVPIGRVQVAQFQTVPQAGMLGLHPEPLTDNFRPLQPLGGRSILAS
Download sequence
Identical sequences ENSSTOP00000016387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]