SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016484 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016484
Domain Number 1 Region: 121-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.55e-16
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 163-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000848
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016484   Gene: ENSSTOG00000001503   Transcript: ENSSTOT00000001498
Sequence length 303
Comment pep:known_by_projection scaffold:spetri2:JH393791.1:129477:130385:1 gene:ENSSTOG00000001503 transcript:ENSSTOT00000001498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTPSPDPLPSTLTGEEEKPLALLPPVPRGRRGRPPGGAASSNRTLKASFPRKRGRPPKS
GQEPPLAQELTSQVGSGGGSDLLLIDDQGVPYTVSERSAAGGPQGSVSRRAPHFCPVCLR
AFPYLSDLERHSISHSELKPHECKDCGKTFKRSSHLRRHCNIHAGLRPFCCQLCPRRFRE
AGELAHHHRVHSGERPYQCPVCWLRFTEANTLRRHSKRKHPEALGMPLCPPDPRPETPWD
EEEGIPATAGVCEEGPEGKEPACPAPSASASRSWLTARSSAGTGPRQVGQDTLTSGGLPV
LGG
Download sequence
Identical sequences ENSSTOP00000016484 ENSSTOP00000016484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]