SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016593 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016593
Domain Number 1 Region: 464-662
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.85e-69
Family Hemopexin-like domain 0.00000000223
Further Details:      
 
Domain Number 2 Region: 89-218,391-446
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.74e-38
Family Matrix metalloproteases, catalytic domain 0.000000329
Further Details:      
 
Domain Number 3 Region: 277-334
Classification Level Classification E-value
Superfamily Kringle-like 2.14e-21
Family Fibronectin type II module 0.0000617
Further Details:      
 
Domain Number 4 Region: 337-393
Classification Level Classification E-value
Superfamily Kringle-like 1.4e-20
Family Fibronectin type II module 0.0000694
Further Details:      
 
Domain Number 5 Region: 221-276
Classification Level Classification E-value
Superfamily Kringle-like 6.85e-20
Family Fibronectin type II module 0.0000577
Further Details:      
 
Domain Number 6 Region: 42-107
Classification Level Classification E-value
Superfamily PGBD-like 3.45e-19
Family MMP N-terminal domain 0.0000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016593   Gene: ENSSTOG00000022615   Transcript: ENSSTOT00000026820
Sequence length 662
Comment pep:known_by_projection scaffold:spetri2:JH393285.1:7801403:7825871:1 gene:ENSSTOG00000022615 transcript:ENSSTOT00000026820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAPGAWVALARPLRALCVLGCLLGRAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSSVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GREYTSCTDAGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQGT
SYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKH
ESCTSAGRSDGKMWCATSANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGVSPDTDIDTGTGPTPTLGPVTPEICKQDIVFDGI
AQIRGEIFFFKDRFIWRTVNPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGN
EYWVYSASTLERGYPKPLTSLGLPPDVQKVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKM
DPGFPKLIADAWNAISDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKVGSIKSDWL
GC
Download sequence
Identical sequences I3MWU8
ENSSTOP00000016593 XP_005318241.1.77405 ENSSTOP00000016593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]