SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016616 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016616
Domain Number 1 Region: 206-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000022
Family VWC domain 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000016616
Domain Number - Region: 153-213
Classification Level Classification E-value
Superfamily FnI-like domain 0.000429
Family Fibronectin type I module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016616   Gene: ENSSTOG00000019832   Transcript: ENSSTOT00000020219
Sequence length 325
Comment pep:known_by_projection scaffold:spetri2:JH393496.1:1861766:2015207:-1 gene:ENSSTOG00000019832 transcript:ENSSTOT00000020219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSTAMAVGALSSSLLVTCCLMVALCSPSIPLEKLAQAPEQPGQEKREHASRDGPGRVS
ELGRAARDEGSSARDWKSKSNRGFSSREAWSKQKQAWGVQGGGAKAADLQVRPRGDTPQG
EIPAAAAQDAISRELAPTPELPEEYAYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLC
TEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERCR
CEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTIC
HCTYEEGTWRIERQAMCTRHECRQM
Download sequence
Identical sequences I3MWX1
ENSSTOP00000016616 ENSSTOP00000016616 XP_005337605.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]