SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016633 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016633
Domain Number 1 Region: 408-545
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.92e-34
Family Mismatch glycosylase 0.000000148
Further Details:      
 
Domain Number 2 Region: 31-151
Classification Level Classification E-value
Superfamily DNA-binding domain 7.19e-32
Family Methyl-CpG-binding domain, MBD 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016633   Gene: ENSSTOG00000020663   Transcript: ENSSTOT00000024956
Sequence length 549
Comment pep:known_by_projection scaffold:spetri2:JH393412.1:957560:964427:1 gene:ENSSTOG00000020663 transcript:ENSSTOT00000024956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRRCVHDEDVAVGSERVGEDERPIAIKRISECEPLLQEAIASSQLGDPAVTECHKPVPCG
WERVVKQRLSGKTAGRFDVYFISPQGLKFRSRSSLANYLYKHGETSVKPEDFDFTVLSKR
GIRSRSKDSNVAAPTAQLQNESHISTRNLRTRSRWKKVFPLPSSNSELQDSRGLSSPESI
QVLLEEDEGSNDGNSRKVSKCKRKVTILKGIPIKKTKRRCRKSLSGSVESNDKGESPCDQ
TDAEREPVTQDGELGRTLCISDARLSDKTLSVTDKVKSTVKENSPNSGSDVHSEQITSGA
PNKLCSTKEAERNKKYGETNLESEENRSKGDEGQRKEHLHMDLLKCGFETDNKCSQGKRG
FTSEKIFHEDTTIPRTQVEKRKTSLYFSSKYSREALSPPRRKAFKKWTPPRSPFNLVQET
LFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYPSAEVARTADWRDVSELLKPLGLYDL
RAKTIIKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPQDHKLNKYHDWLW
ENHEKLSLS
Download sequence
Identical sequences ENSSTOP00000016633 ENSSTOP00000016633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]