SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016655 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016655
Domain Number 1 Region: 31-105
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000581
Family Growth factor receptor domain 0.0045
Further Details:      
 
Domain Number 2 Region: 100-165
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000387
Family Fibronectin type I module 0.049
Further Details:      
 
Domain Number 3 Region: 229-274
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000497
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016655   Gene: ENSSTOG00000019882   Transcript: ENSSTOT00000023470
Sequence length 383
Comment pep:known_by_projection scaffold:spetri2:JH393418.1:151166:156391:-1 gene:ENSSTOG00000019882 transcript:ENSSTOT00000023470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKLLGKINHTNTLVMFMQWAGTKALSTCPAACQCPLEVPKCAPGVGLVRDGCGCCKVCAK
QLNEDCSKMQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCK
HQCTCIDGAVGCIPLCPQELSLPNLGCPNPRLVKVTGQCCEEWVCDEDGGKDPMDDQDDL
LGKGLGFDASEVELTRNNELIAVGKGGLLKRLPVFGMEPRILYNPLHGQKCIVQTTSWSQ
CSKTCGTGISTRVTNDNPECRLVKETRICEVRPCGQPVYSSLKKGKKCSKTKKALEPVRY
TYAGCSSVKKYRPKYCGSCVDGRCCTPQQTRTVKMRFRCEDGETFSKNVMMIQSCKCNYN
CPHANEAAFPFYRLFNDIHKFRD
Download sequence
Identical sequences ENSSTOP00000016655 ENSSTOP00000016655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]