SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016704 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016704
Domain Number 1 Region: 27-137
Classification Level Classification E-value
Superfamily FKBP-like 2.75e-43
Family FKBP immunophilin/proline isomerase 0.0000625
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016704   Gene: ENSSTOG00000028785   Transcript: ENSSTOT00000021302
Sequence length 140
Comment pep:known_by_projection scaffold:spetri2:JH393409.1:4958413:4961164:-1 gene:ENSSTOG00000028785 transcript:ENSSTOT00000021302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLSWILTVLSVCLSALAIATRAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLED
GTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIP
GGATLVFEVELLKIERRSEL
Download sequence
Identical sequences I3MX59
ENSSTOP00000016704 XP_005333561.1.77405 XP_005333562.1.77405 XP_005333563.1.77405 XP_013217411.1.77405 ENSSTOP00000016704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]