SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016758 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016758
Domain Number 1 Region: 20-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.07e-90
Family Carbonic anhydrase 0.000000000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016758   Gene: ENSSTOG00000027815   Transcript: ENSSTOT00000020015
Sequence length 338
Comment pep:known_by_projection scaffold:spetri2:JH393390.1:545134:554491:1 gene:ENSSTOG00000027815 transcript:ENSSTOT00000020015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFFALLLEVIWILAADGGHHWTYEGPHGQDHWPASYPECGSNAQSPIDIQTDSVTFDPE
LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPPTLYLGGLPRKYAAAQLHLHWGQKGSPGG
SEHQINSEATVAELHMVHYDSDSYGSLSEAAQRPQGLAVLGILIEVGETENPAYEHILSH
LHEIRHKDQKTSVPPFNVGELLPPQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQ
LEKLQETLFSTEEEPSEPLIQNYRAPQPLNQRTVFASFTQGDSPRLRTGEMLSLGVGILI
GCLCLLLAVYFIVRKIRKKRLGNRKSVVFTSAQATTEA
Download sequence
Identical sequences ENSSTOP00000016758 ENSSTOP00000016758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]