SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016856 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016856
Domain Number 1 Region: 62-300
Classification Level Classification E-value
Superfamily PLP-binding barrel 7.29e-68
Family Alanine racemase-like, N-terminal domain 0.000000171
Further Details:      
 
Domain Number 2 Region: 276-426
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.74e-33
Family Eukaryotic ODC-like 0.000097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016856   Gene: ENSSTOG00000020547   Transcript: ENSSTOT00000023932
Sequence length 431
Comment pep:novel scaffold:spetri2:JH393284.1:14672805:14681705:1 gene:ENSSTOG00000020547 transcript:ENSSTOT00000023932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAEVSGTSTHLGGLKESLRSPGSPWPAELIALGPGGSARQEVLRKIQELSDSIHRDPFMV
ADLDMLASRHATFRQALPRVWPFYAVKCSSSPWVLRVLAALGTGFDCASQVELEQVLSLG
VAPSRIIFANPCKASAHIQYAAHRGVKLLTFDSEEELTKVAKHHPEARLVLRILAEDSKS
RFPLNTKFGASLEACGHLLTRARDLGLAVVGVSFHVGSDCQTPQSFAQAIADCRRVFQMG
HGAGHHMSLLDLGGGFPGAEGSEPAFEEMASVINAALAQDFPEDTGVEVIAEPGRFYMAS
VCTAAVNIIGKKAVLGPGGHRKLLYYLNEGQYGSFRIFLREPTPRTPIVVKEFLSEPRLF
PCTLYGPTCDAFDRLSLEEVWLPELDVGDWLIFPSVGAYTCSMSSTFNGFLPANVCYALG
PQLRCLEEEVG
Download sequence
Identical sequences ENSSTOP00000016856 ENSSTOP00000016856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]