SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016924 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016924
Domain Number 1 Region: 5-416
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 6.83e-166
Family Phosphoglycerate kinase 0.000000000000514
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016924   Gene: ENSSTOG00000025730   Transcript: ENSSTOT00000028559
Sequence length 417
Comment pep:novel scaffold:spetri2:JH393427.1:3604355:3605608:-1 gene:ENSSTOG00000025730 transcript:ENSSTOT00000028559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSNKLTLDKLDVKGKRVIMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLANGAKSVVL
MSHLGRPDGVPMPDKYSLEPVAAELKSLLGKDVLFLKDRVGPEVEKACANPPAGSVILLE
NLCFHVEEEGKGKDASGNKVKAEPAKVEAFRESLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGM
AFTFLKVLNNMEIGTSLFDEEGSKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQ
ATVASGIPAGWMGLDCGPESSKKYAEAVGRTKQIVWNGPVGVFEWEAFARGTKALMDEVV
KAIARGCITIIGGGDTATCCAKWNTQDKVSHVSTGGGASLELLEGKVLPGVDALSNV
Download sequence
Identical sequences ENSSTOP00000016924 ENSSTOP00000016924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]