SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016961 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016961
Domain Number 1 Region: 385-473
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.15e-16
Family Growth factor receptor domain 0.00082
Further Details:      
 
Domain Number 2 Region: 174-244
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000199
Family VWC domain 0.018
Further Details:      
 
Domain Number 3 Region: 110-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000209
Family VWC domain 0.026
Further Details:      
 
Domain Number 4 Region: 45-118
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000324
Family VWC domain 0.011
Further Details:      
 
Domain Number 5 Region: 236-308
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000921
Family VWC domain 0.012
Further Details:      
 
Domain Number 6 Region: 331-385
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000418
Family VWC domain 0.019
Further Details:      
 
Domain Number 7 Region: 3-53
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000136
Family VWC domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016961   Gene: ENSSTOG00000026665   Transcript: ENSSTOT00000020168
Sequence length 475
Comment pep:novel scaffold:spetri2:JH393486.1:1874210:1913087:1 gene:ENSSTOG00000026665 transcript:ENSSTOT00000020168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DATVWKPDSCQNCRCHGNIIICKPVVCRNPQCAFEKGEVLQIAANQCCPECVSRTPGSCH
HEERIHEHGTEWASSPCSVCSCTHGEVRCTPQPCPRLSCGPQELEFIPEGSCCPVCVGPG
KPCSYEGRVFEDGEDWRLSQCAKCVCRNGVVQCFAAQCLPLFCNQDEIIVRDPGNCCPQC
SAQSCSVAGQVHKHGEQWTEDACTTCTCDQGEIRCHTQACPPLRCEKGQSRARHHGQCCE
ECVSPFGSCTSNGIVRYQDEMWKGSACEFCVCDRGQVTCQTGECAKVECAQGEELIHLDG
KCCPECISRNGHCVYEEKAEFISSNAGEIKYIPEGHKWEDGPCRVCECRGAQVTCYEPSC
PPCPVATVALQVKGQCCPDCTSVRCHPDCLTCSHSPDHCDLCQDPTQLLQNGRCVHSCGP
GFYQAGSLCLACQPQCSTCSSGLECSSCQPPLLMRRGQCVSTCGEGFYQDRHSCE
Download sequence
Identical sequences ENSSTOP00000016961 ENSSTOP00000016961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]