SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017019 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017019
Domain Number 1 Region: 28-97
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number 2 Region: 92-162
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000068
Family Fibronectin type I module 0.083
Further Details:      
 
Domain Number 3 Region: 191-236
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000549
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017019   Gene: ENSSTOG00000024729   Transcript: ENSSTOT00000026348
Sequence length 344
Comment pep:known_by_projection scaffold:spetri2:JH393280.1:16110514:16121772:-1 gene:ENSSTOG00000024729 transcript:ENSSTOT00000026348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALAPAPTAMTFTPAPLEDTTASPQFCKWPCECPPSPPHCPLGVSLITDGCECCKICAQQL
GDNCTEAAVCDPHRGLYCDYSGDRPRYAIGVCAQVVGVGCMLDGVRYLNGESFQPNCKYN
CTCIDGAVGCTPLCLSTRPPRLWCRRPRRVNLKDQCCEQWVCEDDARRPRKTTLRDTSAS
EAAGEVELWHGNCIAYTSPWSPCSTTCGLGVSTRISNINPRCWPEQESRLCNLRPCDVDI
RLHIKAGKKCLAVYQPETPMNFTLAGCVSTHSYRPKYCGVCMDNRCCIPYKSKTIDVSFQ
CPEGPGFSRQVLWINACFCNLTCRNPNDIFADLESYPEFSEIAN
Download sequence
Identical sequences ENSSTOP00000017019 ENSSTOP00000017019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]