SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017342 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017342
Domain Number 1 Region: 355-703
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.54e-135
Family Transferrin 0.00000000089
Further Details:      
 
Domain Number 2 Region: 21-346
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.4e-123
Family Transferrin 0.00000000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017342   Gene: ENSSTOG00000021276   Transcript: ENSSTOT00000022093
Sequence length 703
Comment pep:novel scaffold:spetri2:JH393339.1:6866670:6895871:1 gene:ENSSTOG00000021276 transcript:ENSSTOT00000022093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQLTWILSLTSASRGLCVAVPEKTVRWCTVSDQEDTKCSSFRDNVKKVFQADGPLVTCVK
RTSYLECIRAIVANEADAVTIDGGLVFEAGLAPYNLKPIVEEFYGPKDDPQTYYYAVALV
KKGTGFQLNQLQGKKSCHTGLGWSSGWNIPISMLLPSGSLETAAARFFSSSCVPCADGKS
FPSLCQLCVGKGTDKCACSSHEPYFGNSGAFKCLEDGAGDVAFVRHVTVFENLEQKADRD
QYELLCPDNTRKPVDEYENCHLAQVPSHAVVARSVDGKEDLIWELLNQAQEHFGKDKSSG
FQLFSSPLGKDLLFTDAAHGFLRVPRKMDAKLYLGYEYYSLTQHLKGAIPGVEDSQKVQW
CAVGHQEKAKCDQWSAVSGGALACTTEETPEDCIAAIVKGDADAMSLDGGFVYIAGHCGL
VLVLAENYEPKQGSERLGSKCVNAPLDGYYVVAVVKKSDADITWDTLRGKKSCHTAVGTS
AGWNVPMGLIHNQTGSCKFDEFFSRSCAPGSDPDSHLCALCGGSSHPAHMCAPSSHEKYH
GSSGALRCLVEKGDVAFVRHSAVLRNTDGKNTEAWAKNLKQKDFELLCLDGTRKPVTEAH
SCHLATVPNHAVVSRKDKADFVRRILFNQQELFGRNGFEYMMFQMFESSTKDLLFSDDTE
CLANLQNKTTFEKFLGPEYLVAMANLKPCLTSELLEACTFHRK
Download sequence
Identical sequences ENSSTOP00000017342 ENSSTOP00000017342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]