SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017359 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017359
Domain Number 1 Region: 7-363
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 4.19e-100
Family Glutaminase/Asparaginase 0.0000000724
Further Details:      
 
Domain Number 2 Region: 399-560
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-23
Family Ankyrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017359   Gene: ENSSTOG00000023161   Transcript: ENSSTOT00000022014
Sequence length 564
Comment pep:known_by_projection scaffold:spetri2:JH393431.1:1141375:1163614:-1 gene:ENSSTOG00000023161 transcript:ENSSTOT00000022014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAAAPERRVLAVYTGGTIGMRSQQGVLVPGGGLATILRALPMFHDQEHAQVCSLPNDT
LVLPPAGPDQRIIYTVLECQPLFDSSDMTITEWVQIAQTIERHYDQYHGFVVIHGTDTMA
FAASVLSFMLENLQKPVILTGAQVPIHALWNDGRENLLGALLMAGQYIIPEVCLFFQNQL
FRGNRATKVDNRRFAAFCSPNLPPLATVGVDITINRELVRKASSKDRLVVCSRMERDVGL
LRLFPGIPASLVRAFLQPPLKGVVMETFGSGNGPTKPDLLQELQAAAERGLVIVNCTHCL
QGTVTSDYASGTALAGAGVISGFDMTSEAALAKLSYVLGQPGLSLDDRKKLLAQDLRGEM
TLPAVDECWSSLQGSTLSRAVSWLLRLSISQEAEALRDALMPSLALAAAHSGDLEALQAL
EELGSGLSLEDPIGQTLLRVAAQRGHAGVVAMLLQRGVDVNARDQDGPSPLLLAVRGRHR
GVTGLLRAAGACLSPQELEDAGTELCRLASRADSEGLRVWWQAGADLGQPGYDGRSALHM
VEAAGNPEVSAVLQSLEGGVGAQA
Download sequence
Identical sequences I3MZ13
ENSSTOP00000017359 XP_005334707.1.77405 ENSSTOP00000017359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]