SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017536 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017536
Domain Number 1 Region: 2-372
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.49e-47
Family Quinoprotein alcohol dehydrogenase-like 0.032
Further Details:      
 
Domain Number 2 Region: 657-781,936-1074
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.2e-42
Family WD40-repeat 0.002
Further Details:      
 
Domain Number 3 Region: 1346-1432,1621-1766,1824-1892
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.84e-41
Family WD40-repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 1344-1651
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.48e-28
Family WD40-repeat 0.0018
Further Details:      
 
Domain Number 5 Region: 479-544,660-754,802-941
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 4.63e-17
Family Quinohemoprotein amine dehydrogenase B chain 0.055
Further Details:      
 
Domain Number 6 Region: 1031-1203
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000565
Family Quinoprotein alcohol dehydrogenase-like 0.014
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000017536
Domain Number - Region: 388-402,433-528
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0301
Family Galactose oxidase, central domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017536   Gene: ENSSTOG00000021646   Transcript: ENSSTOT00000022031
Sequence length 1894
Comment pep:known_by_projection scaffold:spetri2:JH393301.1:1254546:1405364:1 gene:ENSSTOG00000021646 transcript:ENSSTOT00000022031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLALHPDKTLIATGQVGKEPYICIWDSYNVQTVSILKDVHTHGVACLAFDSDGQRLASV
GLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQPNRVVSCGVKHIKFWTLCGNAL
TAKRGIFGKTGDLQTILCLACAKEDVTYSGALNGDIYVWKGLNLVRTIQGAHSAGIFSMY
ACEEGFATGGRDGCIRLWDTDFKPITKIDLRETEQGYKGLSIRSVCWRADRLLAGTQDSE
IFEVIVRERDKPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARCN
MEEAVRSVAFSPDGSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYLA
VGSNDGPVDIYAVAQRYKKIGECNKSLSFITHIDWSLDSKYLQTNDGAGDRLFYKMPSGK
PLTSKEEIKGIPWASWTCVKGPEVSGIWPKYTEVTDINSVDANYNSSVLVSGDDFGLVKL
FKFPCLKKGAKFRKYVGHSAHVTNVRWSHDCQWVLSTGGADHSVFQWRFIPEGVSNGMLE
TAPQENSLSEESGHSPPCHGDVPREMMVVKNEKDIIYLRKVYKEDLPQLKQQSKEKNHAM
PFLKREKAPEDSLKLQFIHGYRGYDCRNNLFYTQAGEVVYHIAAVAVVYNRQQHSQRLYL
GHDDDILSLTIHPVKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVCALDFSADG
KCLVSVGLDDFHSIVFWDWKKGEKIATTRGHKDKIFVVKCNPHHVDKLVTVGMKHIKFWQ
QAGGGFTSKRGIFGSAGKLETMMCVSYGRMEDLVFSGAATGDIFIWKDVLLLKTVKAHDG
PVFAMYALDKGFVTGGKDGIVELWDDMFERCLKTYAIKRAALSTSSKGLLLEDNPSIRAI
TLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRI
WELSSQHRMLAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTVEDMVSFHHRKEM
ISDIKFSKDTGKYLAVASHDNFVDIYNVLTSKRVGICKGASSYITHIDWDSRGKLLQVNS
GAKEQLFFEAPRGKRHIIRPSEIEKIEWDSWTCVLGPTCEGIWPVHSDVTDVNAASLTKD
CSLLATGDDFGFVKLFSYPVKGQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGADTALM
IWTREFVGTQESKLVDSEESDTDAEEDGGYDSDVAREKAIDYTTKIYAVSIREMEGTKPH
QQMKEVSMEERPPVSRAAPQPEKLQKNNITKKKKLVEELALDHVFGYRGFDCRNNLHYLN
DGADIIFHTAAAGIVQNLSTGSQSFYLEHTDDILCLTVNQHPKYRNVVATSQIGTTPSIH
IWDAMTKHTLSMLRCFHSKGVNYVNFSATGKLLVSVGVDPEHTITVWRWQEGAKVASRGG
HLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSALLYKKGVIGSMEAAKMQTMLSVAFG
ANNLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGA
VKLWDQEMKRCRAFQLETGQLVECVRSVCRGKGKILVGTKDGEIIEVGEKNAASNILIDG
HMEGEIWGLATHPSKDIFISASNDGTARIWDLADKKLLNKVNLGHAARCAAYSPDGDMVA
IGMKNGEFVILLVNSLKVWGKKRDRKSAIQDIRISPDNRFLAVGSSEHTVDFYDLTQGTS
LNRTGYCRDIPSFVLQMDFSADSKYIQVSTGAYKRQVHEVPLGKQVTEAMVIEKITWASW
TSILGDEVIGIWPRNADKADVNCACVTHAGLNIVTGDDFGLVKLFDFPCTEKFAKHKRYF
GHSAHVTNIRFSYDDKYVVSTGGDDCSVFVWRCL
Download sequence
Identical sequences ENSSTOP00000017536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]