SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017586 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017586
Domain Number 1 Region: 230-333
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.41e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 88-194
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.94e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.046
Further Details:      
 
Domain Number 3 Region: 5-53
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000109
Family HLH, helix-loop-helix DNA-binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017586   Gene: ENSSTOG00000027359   Transcript: ENSSTOT00000024241
Sequence length 333
Comment pep:novel scaffold:spetri2:JH393461.1:1894209:1910503:-1 gene:ENSSTOG00000027359 transcript:ENSSTOT00000024241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRVVFPEGL
GEAWGHSSRTSPLDNVGRELGSHLLQTLDGFIFVVAPDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPADHDEMTAVLTAHQPYHSHFVQEYEIERSFFLRMKCVLAKRNAGLTCGGY
KVIHCSGYLKIRQYSLDMSPFDGCYQNVGLVAVGHSLPPSAVTEIKLHSNMFMFRASLDM
KLIFLDSRVAELTGYEPQDLIEKTLYHHVHGCDTFHLRCAHHLLLVKGQVTTKYYRFLAK
HGGWVWVQSYATIVHNSRSSRPHCIVSVNYVLT
Download sequence
Identical sequences XP_014735911.1.99236 ENSSTOP00000017586 ENSSTOP00000017586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]