SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017879 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017879
Domain Number 1 Region: 177-329
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 7.9e-38
Family 4HBT-like 0.00057
Further Details:      
 
Domain Number 2 Region: 11-154
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 2.19e-27
Family 4HBT-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017879   Gene: ENSSTOG00000025379   Transcript: ENSSTOT00000025234
Sequence length 336
Comment pep:known_by_projection scaffold:spetri2:JH393433.1:1111974:1171932:-1 gene:ENSSTOG00000025379 transcript:ENSSTOT00000025234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GASSAHPFLLSRPRIMRPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGERCVAAL
ARVERTDFLSPMCIGEVAHVSAEITYTSKHSVEVQVNVMSENILTGTKKLTNKATLWYVP
LSLKNVDKVLEVPPVVYSRQEQEEEGRKRYEAQKLERMETKWRNGDIVQPVQNPEPNTVS
YSQSSLIHLVGPSDCTLHGFVHGGVTMKLMDEVAGIVAARHCKTNIVTASVDAINFHDKI
RKGCVITISGRMTFTSNKSMEIEVLVDADPVVDNSQKRYRAASAFFTYVSLSQEGKSLPV
PQLVPETEDEKKRFEEGKGRYLQMKAKRQGHTEPQP
Download sequence
Identical sequences ENSSTOP00000017879 ENSSTOP00000017879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]