SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017987 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017987
Domain Number 1 Region: 12-215
Classification Level Classification E-value
Superfamily Heme oxygenase-like 3.61e-53
Family Eukaryotic type heme oxygenase 0.000000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017987   Gene: ENSSTOG00000027240   Transcript: ENSSTOT00000026125
Sequence length 282
Comment pep:novel scaffold:spetri2:JH393290.1:6364321:6366486:1 gene:ENSSTOG00000027240 transcript:ENSSTOT00000026125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEGQQSNSLPRDLCKALKEATKEVHTQAENAEFMRNFQKGQVTRKGSKLVMVSLYHVYLA
LEEQIHNTDNPVFAPLYFPEELHHRATLEQDMAFWYRPCWQQAVPYTAGRLQQVERREPE
MLVAHAYTHYLGNLSRGQVLKKITHKALDLPSSREGLAFFTFPKVASATKFKQLYHSLMN
TLEMTPEVRQRVIKEAKTAFLLNIKLFEELQELPTQDPEDQRPSQTAGLRHRASSQVRAF
WAPTEREEGVVPLEQSTERALMHLSLELSFLNMSLKTGSYYM
Download sequence
Identical sequences ENSSTOP00000017987 ENSSTOP00000017987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]