SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018114 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018114
Domain Number 1 Region: 30-549
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-105
Family ALDH-like 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018114   Gene: ENSSTOG00000009060   Transcript: ENSSTOT00000022710
Sequence length 565
Comment pep:known_by_projection scaffold:spetri2:JH393284.1:5218686:5239643:-1 gene:ENSSTOG00000009060 transcript:ENSSTOT00000022710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGLPAAFPLCAGHRWKGAVLRWKHSPSLKVANEPILAFTQGSPEREALQKALKDLKGQT
EAIPCVVGDEEVWTSDVQYQVSVGPVGGEAQPVPECLMSMEPVVSAVDRPLWTPKMCRSK
GHPCCDRQEVLVTGGGGLVSPLRASHPAGTVGKGSTVIQAEIDAAAELIDFFRFNAKFAV
ELEAEQPLSVPPSTNSVVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTA
MLASYAVYRVLREAGLPPNIVQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWKQV
AQNLDRYRTFPRLAGECGGKNFHFVHRSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPS
SLWPQIKGRLLEEHSRIKVGNPAEDFGTFFSAVIDAKSFSRIRKWLEHARSSPSLTILAG
GKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLTVYVYPEDKYRETLRLVDSTTSYGL
TGAVFAQDKDVIQEATKMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYI
LRWTSPQVIKETHAPLGDWRYSYMQ
Download sequence
Identical sequences ENSSTOP00000018114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]