SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018177 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018177
Domain Number 1 Region: 33-514
Classification Level Classification E-value
Superfamily ALDH-like 4.71e-185
Family ALDH-like 0.000000000000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018177   Gene: ENSSTOG00000013325   Transcript: ENSSTOT00000013323
Sequence length 519
Comment pep:known_by_projection scaffold:spetri2:JH393334.1:6085518:6087077:1 gene:ENSSTOG00000013325 transcript:ENSSTOT00000013323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSMLRFLVPRLLCLQGRTARYFSAAALPSPISNPDIRYNQLFINNEWQDAVSKKTFPTVN
PTTGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVY
LASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGV
CGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNII
TGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADA
DMGHAVDQCHEALFFNMGQCCCAGSRTFVEESIYDEFLERTVEKAKQRKVGNPFELDTQQ
GPQVDKEQFERILGYIRLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMTIAKEEIF
GPVQPLFKFKKIEEVIERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTC
HTPFGGFKESGNGRELGEDGLRAYTEVKTVTIKVPQKNS
Download sequence
Identical sequences ENSSTOP00000018177 ENSSTOP00000018177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]