SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018321 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018321
Domain Number 1 Region: 3-476
Classification Level Classification E-value
Superfamily ALDH-like 3.67e-164
Family ALDH-like 0.0000000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018321   Gene: ENSSTOG00000026675   Transcript: ENSSTOT00000028024
Sequence length 478
Comment pep:known_by_projection scaffold:spetri2:JH393481.1:843540:862706:1 gene:ENSSTOG00000026675 transcript:ENSSTOT00000028024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTESFVGGRWLPAAATFPVYDPASGATLGMVADCGVPEARAAVHAAHEAFCSWKEVSVKE
RSSLLRKWYDLMMQNKGDLAKLITAESGKPLKEAEAEVLYSALFLEWFSEEARRIYGDVI
YPSAKGRRALVLKQPLGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALA
LAQLANEAGIPPGVYNVVPCSRSKAKEVGKALCTDPLVSKISFTGSTATGKVLLHYAADS
VKRVSMELGGLAPFIVFDSANVDQAVDGALASKFRNAGQTCVCSNRFLVQSGIHDSFVKK
FAEAMKRNLRVGNGFEAGTTQGPLINEKAVEKVEKHVSDAVSKGATVVMGGKRHQFGKNF
FEPTLLSSVTKDMLCAHEETFGPLAPVIKFDTEEEAVAIANATEVGLAATGYFYSQDPAQ
IWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEVKYVCYGGL
Download sequence
Identical sequences ENSSTOP00000018321 ENSSTOP00000018321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]