SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018441 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018441
Domain Number 1 Region: 44-159
Classification Level Classification E-value
Superfamily FKBP-like 6.09e-39
Family FKBP immunophilin/proline isomerase 0.00017
Further Details:      
 
Domain Number 2 Region: 150-267
Classification Level Classification E-value
Superfamily FKBP-like 2.36e-38
Family FKBP immunophilin/proline isomerase 0.00041
Further Details:      
 
Domain Number 3 Region: 271-382
Classification Level Classification E-value
Superfamily FKBP-like 1.92e-36
Family FKBP immunophilin/proline isomerase 0.00032
Further Details:      
 
Domain Number 4 Region: 377-482
Classification Level Classification E-value
Superfamily FKBP-like 2.16e-33
Family FKBP immunophilin/proline isomerase 0.00036
Further Details:      
 
Domain Number 5 Region: 487-563
Classification Level Classification E-value
Superfamily EF-hand 0.000000000216
Family Calbindin D9K 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018441   Gene: ENSSTOG00000019843   Transcript: ENSSTOT00000029905
Sequence length 574
Comment pep:known_by_projection scaffold:spetri2:JH393288.1:8733968:8783956:1 gene:ENSSTOG00000019843 transcript:ENSSTOT00000029905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRVRGSRPLPPPLLLLLLWVTGQAAPVAGLGLGSDAELQIERRFVPDECPRTVRSGDF
VRYHYVGTFPDGQKFDSSYDRGSTFNVFVGKGQLIAGMDQALVGMCVNERRFVKIPPKLA
YGSEGVSGVIPPNSVLHFDVLLMDIWNSEDEVQIHTYFKPPSCSRTIQVSDFVRYHYNGT
FLDGTLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVGEKRIITIPPFLAYGEDGDGK
DIPGQASLVFDVALLDLHNPKDSISIENKVIPANCERRSQSGDFLRYHYNGTLLDGTFFD
SSYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGERRRIVVPPHLGYGEEGRGNIPGSAVLV
FDIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTY
NIVLGSGQVVLGMDMGLREMCVGEKRTVVIPPHLGYGEAGVDGEVPGSAVLVFDIELLEL
VAGLPEGYMFIWNSEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVATGKGKLAPGFDAEM
IVKNMFTNQDRNGDGKVVAEEFKLKDQETKHDEL
Download sequence
Identical sequences I3N245
XP_005319237.1.77405 ENSSTOP00000018441 ENSSTOP00000018441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]