SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018545 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018545
Domain Number 1 Region: 2071-2230
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.84e-21
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0055
Further Details:      
 
Domain Number 2 Region: 2542-2599
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000126
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 3 Region: 2972-3029
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000968
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 2705-2756
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000275
Family TSP-1 type 1 repeat 0.00078
Further Details:      
 
Domain Number 5 Region: 4004-4061
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000575
Family TSP-1 type 1 repeat 0.00028
Further Details:      
 
Domain Number 6 Region: 3246-3295
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000732
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 7 Region: 4253-4310
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000102
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 
Domain Number 8 Region: 3809-3867
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000262
Family TSP-1 type 1 repeat 0.00075
Further Details:      
 
Domain Number 9 Region: 2816-2872
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000968
Family TSP-1 type 1 repeat 0.00063
Further Details:      
 
Domain Number 10 Region: 3638-3681
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.00073
Further Details:      
 
Domain Number 11 Region: 3945-4004
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000654
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 12 Region: 1568-1606
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 13 Region: 1701-1751
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.00092
Further Details:      
 
Domain Number 14 Region: 3463-3512
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 15 Region: 1417-1458
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 16 Region: 2489-2542
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000471
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 17 Region: 1276-1339
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000497
Family ATI-like 0.062
Further Details:      
 
Domain Number 18 Region: 4618-4671
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000785
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 19 Region: 466-528
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000105
Family BSTI 0.05
Further Details:      
 
Domain Number 20 Region: 3078-3135
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000111
Family ATI-like 0.046
Further Details:      
 
Domain Number 21 Region: 4774-4824
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000012
Family TSP-1 type 1 repeat 0.00098
Further Details:      
 
Domain Number 22 Region: 3177-3237
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 23 Region: 1817-1877
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000144
Family BSTI 0.067
Further Details:      
 
Domain Number 24 Region: 2451-2488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 25 Region: 1381-1417
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 26 Region: 4826-4883
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000183
Family BSTI 0.033
Further Details:      
 
Domain Number 27 Region: 1756-1809
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 28 Region: 1457-1500
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 29 Region: 2935-2991
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000282
Family VWC domain 0.047
Further Details:      
 
Domain Number 30 Region: 823-883
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000474
Family ATI-like 0.054
Further Details:      
 
Domain Number 31 Region: 4986-5053
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000502
Family VWC domain 0.079
Further Details:      
 
Domain Number 32 Region: 3397-3453
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000641
Family TSP-1 type 1 repeat 0.00072
Further Details:      
 
Domain Number 33 Region: 1497-1535
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000107
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 34 Region: 4931-4996
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000144
Family ATI-like 0.015
Further Details:      
 
Domain Number 35 Region: 2389-2428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 36 Region: 4159-4214
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000366
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 37 Region: 3309-3360
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000687
Family BSTI 0.023
Further Details:      
 
Domain Number 38 Region: 2234-2272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000102
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 39 Region: 2622-2667
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000144
Family ATI-like 0.02
Further Details:      
 
Domain Number 40 Region: 4428-4486
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000445
Family ATI-like 0.012
Further Details:      
 
Domain Number 41 Region: 3882-3930
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000615
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 42 Region: 924-978
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000634
Family ATI-like 0.049
Further Details:      
 
Domain Number 43 Region: 4318-4368
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000654
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 44 Region: 4061-4120
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000867
Family BSTI 0.027
Further Details:      
 
Domain Number 45 Region: 1609-1644
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000982
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number 46 Region: 2764-2812
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000101
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 47 Region: 1913-1971
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000129
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 48 Region: 4685-4734
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000131
Family ATI-like 0.085
Further Details:      
 
Domain Number 49 Region: 891-919
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0000249
Family PMP inhibitors 0.0021
Further Details:      
 
Domain Number 50 Region: 3034-3073
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000249
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 51 Region: 976-1017
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000356
Family VWC domain 0.071
Further Details:      
 
Domain Number 52 Region: 2872-2937
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000719
Family ATI-like 0.044
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000018545
Domain Number - Region: 3520-3577
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000311
Family ATI-like 0.043
Further Details:      
 
Domain Number - Region: 3688-3745
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000327
Family BSTI 0.045
Further Details:      
 
Domain Number - Region: 1969-2031
Classification Level Classification E-value
Superfamily FnI-like domain 0.0023
Family VWC domain 0.071
Further Details:      
 
Domain Number - Region: 1661-1687
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0038
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 5063-5154
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.00481
Family Gonadodropin/Follitropin 0.01
Further Details:      
 
Domain Number - Region: 526-566
Classification Level Classification E-value
Superfamily FnI-like domain 0.0105
Family Fibronectin type I module 0.089
Further Details:      
 
Domain Number - Region: 4367-4424
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0144
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number - Region: 4131-4159
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0196
Family PMP inhibitors 0.0029
Further Details:      
 
Domain Number - Region: 4902-4956
Classification Level Classification E-value
Superfamily FnI-like domain 0.0502
Family VWC domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018545   Gene: ENSSTOG00000023004   Transcript: ENSSTOT00000023402
Sequence length 5159
Comment pep:novel scaffold:spetri2:JH393337.1:5824319:5874879:1 gene:ENSSTOG00000023004 transcript:ENSSTOT00000023402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLAVLFGMLWALANGRWCEQTETIHVEEEVAPRKEDLVPCASLYHYTRLGWRLDLPRS
GHEGLSGPPAPGLCRIYKPPETRPATWNRTVRACCPGWGGAQCTDALMEDSPGGHCFATW
QCQPLGGSANTSTENLEECCARPWGHSWWDSGSQLCLSCSSQHFPGNASSAVLLQPLPGA
VGQLWSQHQRFSATCATWSGFHYHTFDGRHYHFLGHCTYLLAGAADSTWAVHLRPRDHCS
QPEHCQLVLVIMGSEEVQIQGRDVSVKGQLIPDGEPQLLHGLSLQWQGDWLVLSGGLGVV
VRLDRSSSVSISVDHEHSGQTQGLCGLYNGRPEDDFSEPGGGLAMLAATFGNSWKLPSSE
PGCLDAVEVDQGCEGPLKGTEAGMDAGQLRAEAQDVCHQLLESPFWQCHAQVSPDEYHEA
CLFAYCAGAALGRQEGRQEAVCATFANYAQACARRRIHVLWRKPGFCERLCPGGQLYSDC
VSSCPPSCSAVGQEEEGSCREECVSGCECPPGLFWDGALCVPASRCPCYHRRQRYAPGDT
VHQLCNPCVCQDGHWHCAQALCPAECAVGGDGHYLTFDGRSFFFRGHSGCHYSLVQTDTN
RQAHSTLRHAHMDLASAAPSIYLPPPPHHQAPFPGAVLVDGQDVGLPWIGTAGLSISRAS
STFLLLRWPGVHVLWGVADPAAYITLAPHHAHQVQGLCGTFTWNQQDDFLTPAGDVETST
ADFASRFQVAGNGKCSSGDSVLLFPCSTHSQHLAFAEATCAILHGPAFQDCHRLVDREPF
QLRCLAAVCGCAPGRDCLCAVLSAYAHRCAQEGALLSWRNQTLCPVLCPGGQEYQECAPV
CGHHCGEPEDCKELTGCVAGCNCPPGLLWDPEGQCVPPSLCSCQLGAHRYSPGSVTMKDC
NRCICQERGLWNCTAHHCALQRAFCPGELVHAPGACLLTCDSPSANHSCPMGSTDGCVCP
PGTVLLDERCVPPDLCPCRHSGQWYPPNATIQDNCNTCVCQGRQWHCTGQLCSGWCQASG
APHYVTFDGLTLTFPGACEYLLVREASGRFSVSAQNLPCGASGLTCTKTLAVRLEGTTVH
MLRGRAVTVNGVSVTPPKAYTGPGISLHRAGLFLLLTTRLGLTLLWDGVMPPGTRVLIQL
SPHFRGRVAGLCGDFDGDASNDLRSRQGVLEPTAELAAHSWRLSALCPEPGDPPHPCTVN
THRAAWARARCGVMLQQLFVPCHTEVPPQQHYEWCVYDTCGCDSGGDCECLCSAIAAYAD
ECARHGHHVRWRSQELCPLQCEGGQVYEACGPTCPPACPTHHAEPAWHCRAIACVEGCFC
PEGTLLHGGICMEPSACPCEWGGSFFPPGTVLQKDCGNCTCQESQWHCGGDSAPCEELVP
DCAEGESPCQGSGHCIPHEWLCDNQDDCGDGSDEEGCATPGCVEGQMSCRSGHCLPLSLL
CDGQDDCGDGTDEQGCPCPHDSLACADGRCLPLTLLCDGHPDCPDAADEESCLAGQVNCI
PGEVSCMDGTCVGTIQLCDGVWDCPDGADEGPGYCPLPSLPVPPASTMPGPSTGSLEGAS
SPLGSASPARSCGPLEFPCGSGECTPRGWRCDQEEDCADGSDELGCGGPCALHHAPCARG
SHCVSPGELCDGVPQCPDGSDEGPDACEGLPPPGSLNRTEFPCPEYSCPNGDCLGFHLVC
DGQPNCELVGEAGLSPEEQGCGTWGPWSPWGPCSQTCGLGVQSQSRSCSPSGLLVLQHCP
GPANQSQACFTKACPVDGEWSSWSSWSLCSEPCGGTRTRQRQCHPPQNGGQACALLPGGP
HSTHQTEPCPQDGCPNATCSGELVFQPCAPCPLTCDDISGQAICSPRRPCSSPGCWCPEG
QVLGSEGQCVWPRQCPCLVDGARYWPGQHIKANCQLCVCQDGRPRRCRPNPDCAINCGWS
SWSPWAECLGPCGSQSIQWSFRSPNNPRLSGRGRQCRGIHRKARRCQTQPCEGCEQQGHT
HQVGERWRGGPCKVCQCLHMGTVHCSPYCPLGSCPQGWILVEGVGESCCHCALPAENQTV
PPTATPAPAPAPSPQTGPPLVTYVLPPLGDACYSPLGLALPPGSLWTWSRQLEPPTWAAL
LGAPTKGPGPRAGAYAEWHSGPPFLQLDLLQPRNLTGVIVWGPTSSSPPGSSFSLQFGTD
GLHWQDYRDILPGTLSPPKSFPRNWEDVASKVWAFSRMVQARYIRVWPHSVPHSDRQPGF
FLWVELLGCEPVPPCPGAGHRCANGDCALRGVPCDGAADCEHGSDEEGCGPLPVDTGRGH
STARTPTFSTQPGPLPPQPSEGLAETDRWHPKQGLSMPPTEKRPVSPAPASKAPHPSSGE
SVQTGSNTPTFHAGFQSLTPGMAATTVLPTHPMIPMTPAGQRVAPSPFPPVRCSPGQLPC
KVLGCVEPEQLCDGKEDCLDGDDERHCVSWAASPMPFMVPTTVLPGLPASRTLCSQSQLS
CGSGECLPTERRCDLRPDCQDGSDEDGCVDCVLAPWSGWSGCSRSCGLGLTFQRRELLRP
PLPGGSCPLDQLRRQPCFVQACPVAGAWAEWETWGPCSVSCGGGHQSRQRSCMDPPPKNG
GAPCPGASWERAPCGLQPCTGDTDCGLGRVHVNAELCQKGLVPPCPPSCLDPETNGSCTG
PCVEGCRCPPGLLLHDSRCLPLSECPCLVGEELKPPGMSFLLDNCSQCICERGTLVCEPG
ACPQPCGWSAWSSWTPCDRSCGSGVRARFRSPSNPPAAFGGAPCEGDKQELQVCHVDCGT
EVLGWTPWTSWSSCSQSCLVPGGVPGWRHRSRLCPGLRDTSCPGEATQEEPCSPPVCPGT
APWGAWASWSACSAPCNGGIQIRGRSCSGSAPGNPACRGPHSQTRDCNTQPCTAQCPEDM
VFRSAEQCHQDGGPCPQLCLAQDSGVECTGFCTPSCTCPPGLFLHNASCLPRSQCPCQLH
GKLYAPGAVARLDSCNNCTCISGEMACTSELCPVACGWSPWTPWSPCSRSCDVGIRRRFR
AGTSPPAAFGGAECQGPNIEAEFCSLRPCQSPGGEWGPWASCSVPCGGGYRNRTRGSGPR
VLMVFSTCNLQPCAGPVPGMCPRGQLWLDCAQGPASCAELSAPRETKQTCHPGCYCPHGM
HLLNNVCVPAQACPCAHEGRLHPPGSAVLRPCENCSCISGLITNCTSWPCEEAQGQPTWS
PWTPWSVCSASCGPARRHRHRFCDRPSSVAPSTLALGPSPATPTPLCPGPEAEEEPCLLP
GCDRAGGWGPWGPWSSCSRSCGGGLRSRTRACDQPPPQGLGDFCEGPQAQGEACQAQPCP
VTDCTAIEGAQYSPCGPPCPRSCDDLVHCVWHCQPGCYCPPGQVLSADGTLCVHPGHCGC
LDLLTGERHRPGAQLARPDGCNHCTCLEGRLNCSELPCPVPGGWCPWSEWTACFQPCRGQ
TRTRSRACACPAPQHGGALCPGEMGAQHQRETCPSSTTCPGTVDGAWSPWGPWSPCDACL
GQSHRSRECSQPPTSEGGRPCPGVHWQSRPCHDNSTQCADCGGGQSLLPCGQPCPRSCLD
LSPGSVCQPGPGGCQPSCGCPPGQLSQDGLCVLPVHCRCQYQPGAMGIPENQSRSAGSGL
SSWESLEPGEVVTGPCNNCTCVAGILQCWEVPSCPGAGVWGPWGPWEDCSVSCGGGEQLR
SRHCARPPCPGLARQSRTCHTQVCREAGCPAGRLYRECLPNGGCPFSCAHVAGRVACFSD
GCEEGCHCPEGTFQHGLACVQECPCMLTALLLRELGASSTDAGVHAASLGEEGQPLRPGD
ELSPGQMFRMGCSNCSCAHGKLSCSIEDCPEAPSFSPWDPWGPCSRSCGGLGTRTRSRQC
VHPALATGGQGCQGPRQDLEYCLSPDCSGAEGSTAEPVTGLPGGWGPWAPWSPCSRSCTD
PTHPAWRSRTRLCLTNCTVGRPSQERPCNLPSCTELQPLCSSPGCGPGNCSWTSWGPWEP
CSRSCGVGQQHRLRAYRPPGPGGHWCPDILTAFQERRFCSLRACPVPGGWSRWSPWSWCD
RSCGGGQSLRSRSCSSPPPKNGGAPCVGEKHHARLCNPMPCEEGCPAGMELVSCANRCPR
RCSDLQEGVLCQDGQACQWGCRCAEGSLEQDSSCVPVGHCECTDAQGHSWAPGSQHQDAC
NNCSCQAGQLSCTAQPCPPPAHCAWSRWSAWSPCSHSCGPRGLQSRFRSSTSGSWAPECQ
EEQSQSQPCPQPPCPPLCLHEGRVHTLGDSWLQGGCQQCSCTPEGIICEDTKCPVTGSWT
LWSLWSDCPVSCGGGNQVRTRACVVPDPHHREPLCQGPDTQTQPCGQQPCQPLLEACSWG
PWGPCSRSCGSGLASRSGSCPCLPAEAEPTCNGTFPHLDTQACYAGPCLEECLWSGWSSW
TRCSCQVLVQQRYRHQGPAPGGTAEGPPCTRLDGHFRPCPTGNCSEDSCTPPFEFQACGS
PCAGLCATHLSRQLCQDLPACQPGCYCPKGLLEQAGACIPPEQCNCWHISEEGAEVTLAP
GDHLQLGCKECECWHGELRCTSGGCAGLLPLSSWSEWSPCGPCLPRSALTRTSRTTLEEH
WPPNTTGLWPPSTSLLVSEQHRHRLCLDPETGRPWAGDPQLCTAPLNQQRLCPDPEACQD
SCQWNPWGPWSPCQVPCSGGFRMRWREAGGLPGGACRGPWAQTQSCNMGPCPGKSCEAKD
TVPTLECANQCPRSCMDLWDRVQCLQGPCSPGCRCPPGQLVQDGHCVPISSCRCGLPSAN
ASWELAPAQVVQLDCHNCTCINGSLVCPHLECPTLGPWSAWSKCSVACGGGTMDRHRSCK
EHPQGALCQAQDMKQQQDCNLQPCPECPSGQVFSACAASCPSLCSHLQPGTICTQEPCQP
GCGCPRGQLLHNGTCVPPAACPCTQLLLPWGLTLTLEEQAQELPPGAVLTRNCTRCTCQD
GAFSCSPIDCQECPPGEMWQHVGPEELGPCEWTCQETNTTAAQGNCSAVQTPGCICQEGY
FRSQAGPCVPADQCECWHHGHLHLLGSEWQEDCESCQCLRGRSVCTRHCPLLNCAQDEVT
VQEPGSCCPTCRRETLDTEAQSASCRHLTELRNLTKGPCHLDQVEVSYCSGHCPSSTNVM
PEEPYLQSQCDCCSYRLDPDSPVRILNLQCPDGRTEPVVLPVINSCQCSACQAGDFSKR
Download sequence
Identical sequences ENSSTOP00000018545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]