SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018776 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018776
Domain Number 1 Region: 157-217
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 1.44e-21
Family VPS23 C-terminal domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000018776
Domain Number - Region: 70-147
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00366
Family FCH domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018776   Gene: ENSSTOG00000024403   Transcript: ENSSTOT00000025168
Sequence length 224
Comment pep:known_by_projection scaffold:spetri2:JH393338.1:775904:808888:1 gene:ENSSTOG00000024403 transcript:ENSSTOT00000025168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSGISAYPSGYPPNPSGYPGCPYPPGGPYPATTSAQYPSQPPVTTVGPSRDGTISEDTI
RASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVNK
NIELLKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLG
EALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
Download sequence
Identical sequences ENSSTOP00000018776 ENSSTOP00000018776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]