SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018826 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018826
Domain Number 1 Region: 17-96
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.00000000000124
Family Ribosomal L11/L12e N-terminal domain 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000018826
Domain Number - Region: 85-152
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.000301
Family Ribosomal protein L11, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018826   Gene: ENSSTOG00000019871   Transcript: ENSSTOT00000027148
Sequence length 157
Comment pep:novel scaffold:spetri2:JH393489.1:2265222:2265727:1 gene:ENSSTOG00000019871 transcript:ENSSTOT00000027148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFLYLSHLQVHPTPDASNTMPKFIPNKIEVIYLRCTSGEVSYCPPVLYPKKDGNNITKAT
SEQQTLRVTVKLTIQNKLAQTEVVPSASTLVIEDLKEKPRDRKEQKNIKSRNIILDEIVN
ITQKMQQQLSEKIKEILGTSQDWSCSVGGYHPHDFIE
Download sequence
Identical sequences ENSSTOP00000018826 ENSSTOP00000018826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]