SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019124 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019124
Domain Number 1 Region: 34-128
Classification Level Classification E-value
Superfamily POZ domain 4.45e-27
Family Tetramerization domain of potassium channels 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019124   Gene: ENSSTOG00000029073   Transcript: ENSSTOT00000023937
Sequence length 327
Comment pep:known_by_projection scaffold:spetri2:JH393321.1:4389733:4390751:1 gene:ENSSTOG00000029073 transcript:ENSSTOT00000023937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALADSTRGLPNGGGGGGGSGSSSSSAEPPLFPDIVELNVGGQVYVTRRCTVVSVPDSLL
WRMFTQQQPQELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPERSRLQREAEYF
ELPELVRRLGAPQQPGPGPPPPHSRRGVHKEGSLGDELLPLGCGEPEQQEGASAGAPSPT
LELASRSPSGGAVGPLLTPSQSLDGSRRSGYITIGYRGSYTIGRDAQADAKFRRVARITV
CGKTSLAKEVFGDTLNESRDPDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTG
TCAFASSTDQSEDKIWTSYTEYVFCRE
Download sequence
Identical sequences I3N428
ENSSTOP00000019124 XP_005324856.1.77405 ENSSTOP00000019124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]